1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
BackLinks Master

Freeware by CleverStat
47 x 1392Kb downloads

...(submitted your site to DMOZ, participated in reciprocal linking programs, or someone mentioned your resource in a...Master helps you to find out who is linking to you, is this link direct or does...several URLs, submit your target keywords to see linking sites with these keywords in anchor text and...
 
reciprocal linksbacklinks softwareback link
QuidProQuo

Freeware by TJ Enterprises LLC
46 x 23068Kb downloads

...the link cheaters (those to whom you are linking but are not returning the favor). With multi-threading...version has a maximum of 2 threads). The software checks links through the Yahoo search engine first...
 
quidproquoverificationreciprocal link checkerreciprocal linkinglink exchange softwarecheckingconfirmation
1site (LITE)

Freeware by Visual Vision
36 x 1937Kb downloads

Free Vista Files award
...Leading professional and easy to use integrated Web editor and Web publishing tool. You can make fancy Websites and Internet pages quickly, as it includes everything you need to create...
 
web publishing softwareweb page editorsightwebsightwebsigthauthoringcreate web sitecreate web pagevisual html editorweb authoring softwareweb editorcreate sitescreate internet pageswysiwyg editor
...VPSpro is an award winning step-by-step business plan software system, which guides entrepreneurs confidentially through the research...feasibility of their business idea or expansion. The software produces a comprehensive set of three-year financial projections...situation and is designed to insure that sponsor linking occurs primarily at the time in the planning...
 
free business planbusiness plan writerwrite business planfinancial analysisbusiness plan exampleprojectionsmall business planwriting business plansample business planbusiness plan softwareventure planning system
eBooksWriter LITE

Freeware by Visual Vision
21 x 2460Kb downloads

Free Vista Files award
...NOT require Internet Explorer, Firefox or any other software installed); - no code / HTML; - full-text...
 
write bookkindlecreate ebookse-bookshandheldelectronic booksipadebook softwareebook compilerebooks writerpalmsony readerebooks editormake ebookexesell bookebooks authoringexe ebookssmartphonenookebooks publishing
...manual submission over time. Directory Site Submitter makes software assisted submissions as efficient as possible. You`ll be...Site Submitter is the best value directory submission software on the market today! Don`t be the last...
 
submitter1-way linkingreciprocal linkingsite submissionseo softwaredirectory submission
Universal Software Oscilloscope Library

Freeware by oscilloscope-lib
37 x 3627Kb downloads

Free Vista Files award
...one micro-second is enough for one discreet. This software can be used for linking to real-time controlling...
 
simulationgui dllchartgraphical user interfacedata acquisitionsoftware oscilloscopedebuggingreal-time plotnetwork monitoringlibrary
Advanced Pathway Painter

Freeware by GSA
30 x 5145Kb downloads

Free Vista Files award
...within the pathways (colours represent the value). The linking between the pathway items and the experiment data...a small part of the functions from the software GENOM 2005....
 
genmappbioinformaticsncbibiocartamicroarrayproteinbiologykegggeneanalysispathwayaffymetrixexperimentsequenceanalyseannotationbioscience
...WebPod Studio is software to produce audio and video PodCasts. This program...the RSS file which will carry the data linking to the actual PodCasts located on the same...
 
vlogaudioaggregatorxmlwebpodpodcastpoddingblogipoddervloggingpodcastingfeedvideobloggingfeedsrss
1site

Commercial by Visual Vision
7 x 1937Kb downloads

...1SITE is a professional easy-to-use Web site creation software. It includes everything you need to make a business or personal Web site in minutes! With 1SITE you will...
 
authoringwebsitewebsigthsitesweb siteinternet pagespublishingbuilderwysiwyg1stsitehomepagedesigneditormake websitesoftwareeasycreate web pagehtmlmakercreatorwebeasyprogramhmtlaffordablebusinessyour own
CD Front End GOLD

Commercial by Visual Vision
15 x 2738Kb downloads

Free Vista Files award
...over sensitive images, sounds, video, forms, Flashâ„¢, visual linking (no broken links, never!): feature rich - can...
 
informixmakerautoplayautorunorderautostartfulcrumcdromdatabasesoftwarecartcreaterunningoraclebuildaccesscsvcatalogvideobuildershoppingimportcataloguesqldbasecreatorpresentationmusicparadoxinterbase
...Add affiliate tracking software to your website/shopping cart, that usis one of...adjust setting per group. 7) Banner and text linking codes system. 8) Manage unlimited affiliates. 9) Adjustable...
 
affiliate program softwarecommission basedtrack comissionspay-per-clicktrack salesaffiliate tracking softwareaffiliate softwarepay-per-sale
EDGE Diagrammer

Shareware by Pacestar Software
16 x 5537Kb downloads

Free Vista Files award
...such as full pan and zoom, poster printing, linking diagrams into documents, curves, importing clip art, and...
 
networkdrawsoftwareorgentityflowchartingchart flowdiagramdesignprogramdataprocesscomputer
WizFlow Flowcharter

Shareware by Pacestar Software
19 x 4547Kb downloads

Free Vista Files award
...Features include full pan and zoom, poster printing, linking diagrams into your documents, curves, importing clip art,...
 
flowchartingprocessdiagramsoftwaredrawarrowsprogramdesign
...Verify that sites who are supposed to be linking to you really are! Manage your reciprocal links,...search the entire site! Our Link Exchange Verification software gives you the ability to spider entire websites...expect there to be on each site. The software does the rest! The sortable results list allows...
 
reciprocal linklink managementlink verification
...reasons you might want to know who is linking to you, but most web-based statistics programs only...hackers if your site isn`t protected properly! This software fixes these problems. It makes it easy to...see who is linking to you, what they are linking to, and...you browse directly to the pages that are linking to you using the in-program browser Removes duplicate...
 
referersreciprocal linksreferrerslink popularity
...JavaScript Execution Enhanced Bar Shading Pop-Up Values URL Linking Auto Scaling Dual Scales Template Scripts and Implementations...
 
bar chartbar graph
...ALink takes the hard work out of setting up and maintaining your Reciprocal Links. Automatically sending requests for new links, checking for links that have been added, removing bad links...
 
alinkreciprocal link softwarereciprocal advertisingreciprocal linksfree link pagereciprocal tradereciprocal link creatorlink checkerreciprocal linkingreciprocal link generator
...Powerful software to find Valuable Expired Domains. Search for onhold,...traffic can have huge value from link popularity. Software also allows you to filter, find whois dropped...all expired domains with traffic. This expired domain software has sorted columns and allows you to check...whois, register domains, view sites linking into your domain, and is multi-threaded for super...
 
domain toolslink popularity toolexpired domain nameexpired domain softwareexpired websiteweb site link popularitycheck link popularitylink popularity software
...managing all your personal information for Internet sites, software licenses, and credit cards just to name a...long to make the passwords. Provides one click linking to web sites and with auto data fill...
 
personal informationweb site managementcodeslicense keysmypasswordscredit cardspins