1 2 3 4 5 6 7 8 9 ... 82 83 84 85 86 87 88 89 90 91

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...UTF-8 files with one translation per line and words separated by tabulators). Hundreds of free bilingual dictionaries...
 
freewareeducationdownloadableapplicationtranslationbilinguallanguagedictionaryoffline
najitool GUI

Freeware by NECDET COKYAZICI
87 x 377Kb downloads

...A list of numbers in English or Turkish words from 1 to 9999 - HTML pages with...0`s) - Dump files in hexidecimal - Count words in a file - Compare files - Reverse...
 
najitoolconvertencryptfreegeneratefilternajigui
...The "Internet Administrator for Microsoft ISA Server" is an integrated solution which allows to control and manage internet access and provides: - all-round internet monitoring; - incoming traffic, time and bandwidth...
 
content filteringweb filteringinternet statisticstraffic controlinternet monitoringinternet access control
Hashgen

Freeware by 2 power n
82 x 195Kb downloads

...of a lookup function for a given static keyset (reserved words of a programming language, assembler mnemonics,...elements, etc.) The generated function will find any key in constant time using exactly one comparison. Every...entry contains a key and arbitrary user-defined atributes associated with that key....
 
functionperfectgeneratorlookuphashedcomparison
...down by search sources, domains and countries, and words and phrases. You can sort results by any...
 
websearchinternetnewssearchfirststopenginemetasearch
CatsCradle

Shareware by Stormdance
67 x 1379Kb downloads

Free Vista Files award
...- Built in Glossary that can suggest appropriate words and phrases while you are translating. - Built...
 
localisingwebtranslatortranslatingcatscradletranslationlocalizationlocalisationlocalizingweb pageweb page editorhtml
ViPNet Password Roulette

Freeware by INFOTECS GmbH
67 x 2724Kb downloads

...of charge software password generator, which generates random passwords so that they can be memorized easily. The...of this software is simple and genius. The passwords are derived from word phrases easy to remember....is a grammatically correct sentence, which consists of words picked up from special dictionaries. These words have...random generator from special vocabularies. The number of words in a phrase can vary from three (subject,...
 
free password generatorpronouncable passwordpassworterzeugerfree random passwordvortexpasswrternpassword roulettefreeware password generatordiplodock
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made that?" Consider the...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Alarm Me

Freeware by Qytec
211 x 997Kb downloads

...No words for this excellent alarm tool. "Alarm me" can...
 
remindershutschedulecountdowndiaryshutdownalarmrestartaddresstimercalendar
Email Subscriber Pro

Freeware by Getfreefile
65 x 610Kb downloads

Free Vista Files award
...subscribe and unsubscribe email requests, and specify two words like SUBSCRIBE and UNSUBSCRIBE used for recognizing requests...
 
bulkremailerextractemailssmtpe-mailmassmailingpop
Back2zip

Freeware by Free-backup.info
176 x 523Kb downloads

Free Vista Files award
...Did you know that 96% of computer users report experiencing serious data loss over a five-year period? In other words, it`s just a matter of time before you...
 
compressiontoolpkzip1st choiceself-extractingfreezipwinzipstuffitebooksecond copyultimateziprestore7-zipquick zipsfxutilitybackupzipitfast
Burning Words Screensaver

Freeware by ElasticSystems.com
175 x 260Kb downloads

...much more is possible thanks to this Burning Words Screensaver and it`s free. You can enter any...
 
fireflameburningwords
ABC Kid Genius

Freeware by kidgen.net
32 x 34181Kb downloads

...Rotating flash word with or without pictures. Spelling words with help, hints or Auto spell which will...spell one word or all words in database automatically. If the word is spelled...correctly a video is played as reward. Words can be added or deleted to the spelling....to use educational TOOL. Create spelling and flash words using your own sound, pictures and video clips...
 
learnlapwarechildrenenglishlessonsspellingcountingalphabetreadingteachchildrensabcfreewaretoddlerseducatenumbersclasseseducationbabiesfree softwareeducationalearly learning
Flashpaste Lite

Freeware by Softvoile
143 x 765Kb downloads

Free Vista Files award
...is all that, and more. Flashpaste has two key features. The first is smart text insertion. While...the material can be inserted by pressing a hotkey to launch a selection list, and navigating to...Enter keys, and more. Anything else? The second key feature is clipboard history. While the standard Windows...
 
clipboard utilitiesinstant pasteinsertionclipboard historypaste textinsert text
File Seeker

Freeware by Qytec
229 x 1954Kb downloads

...Compressed Files (rar,zip,cab...). You can also search for words or phrases inside files of your choice for...
 
filesseekerfastsearch
Tams11 DrawNet

Freeware by Tamera A Shaw-McGuire
62 x 1293Kb downloads

...Test your skills in this drawing charades game. Both the drawer and the player who guesses correctly gets points. Choose to draw Movies, Music, Food and Drink, Phrases, Actions, or...
 
chatonline gamespictionarydrawdownload gameswin lose drawdrawing gamesmultiplayer
Tams11 Squid

Freeware by Tamera A Shaw-McGuire
70 x 1758Kb downloads

...Online word game where you make as many words as you can with the cards provided. This...a new card. Be quick, but form bigger words to score more points. Play online against others...
 
tams11quiddlergamemake wordsscrabbleonlineword gamefreeonline game
Tams11 Worph

Freeware by Tamera A Shaw-McGuire
64 x 1416Kb downloads

...In this unique online word game you form words by morphing the last word you created. You..."cut" to make the word "cute." Create long words for big points. Steal letters from your opponent...
 
word gameworphonline word gameplay word gamescrabbletams11gamesword games
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
114 x 29442Kb downloads

...of the English language. TheSage can look up words directly from almost any program (IE, Word, Firefox,...readily available, quick cross-referencing (any and all displayed words are clickable, triggering a lookup), standard and advanced...
 
speechword listspronunciationdictionarylookupthesageone-clickthesauruswildcard searchconcordancerenglishanagram
LingvoSoft Free Talking Dictionary English <-> Portuguese for Pocket PC

Freeware by ECTACO, Inc.
95 x 2102Kb downloads

...screen rotation in Windows Mobile 2003 SE, virtual keyboards allow the display of European diacritics on devices...consult your device in landscape mode
* Virtual keyboards support VGA and can display European diacritics on...option
* MorphoFinder function helps you find source words (headwords) for English past participles, gerunds, plural forms,...function: start typing in the Input Line and words beginning with those letters will appear on the...
 
pronouncetranslateectacolingvosoftdictionaryspeak