1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...in the forms of: Inline videos, Background sounds, JAVA Applets, Animated gif files, Macromedia Flash movies. Many...
 
interactive videofull-screen with video adsvideo pop-up stoperstop flashvideo pop blockthe video commercialflash animation stoppervideo pop killervideo popup blockstop video popupblock flashvideo popup stopper
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made that?" Consider the...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Fingerprint SDK

Trial by Griaule Technology
244 x 16598Kb downloads

Free Vista Files award
...use. Sample codes provided; * Support for internet Java applets; * International quality assurance: we were successfully...
 
software componentbiometricsmicrosoft fingerprint readerjavadelphicrossmatchfingerprint recognitionlibrarysdkuareusoftware development kittesctech bio-isecugen hamsterappletdigital persona
...100% Free Java Applets ! Real Freeware These products are NOT Trialware...following:- Free Scrolling Text Free Tree Menu Free Java Game - Alien War Free Java Game -...
 
appletsjava appletfree java applet
BackStreet Browser

Shareware by Spadix Software
41 x 1753Kb downloads

...quickly download an entire website including HTML, graphics, Java Applets, sound and other user definable files. In...
 
offline web browseroff-linedownload websiteoff linedownload web siteoffline browserwebsite download
CIS WebServer

Freeware by Cupid Info Systems
26 x 2844Kb downloads

...your visitors. * Supports video, music, images, flash, java applets etc. * Ban IP Address. * Find out...
 
webserverfreewebsiteshost
CoffeeCup Free DHTML Menu Builder

Freeware by CoffeeCup Software
29 x 896Kb downloads

Free Vista Files award
...Create professional-looking DHTML menus for your Website without writing a single line of code. You`ll make great, professional-looking DHTML menus for your Website in no time -- no...
 
appletstextscrolljavaeffectsheadline
Repellent

Freeware by Easy Desk Software
35 x 1633Kb downloads

...a button, you can disable all VB and Java applets and scripting, as well as all Registry files....
 
virus
...also blocks Flash Ads, Background sounds, Inline videos, JAVA Applets and Animated gif files. This program is packed...
 
popup defenderpop-up stopperpopup menupopup blockstop popuppop blockingpopup blockingpop-up stoperpop killerpop-up blocker
JCavaj Java Decompiler

Freeware by Sureshot
98 x 800Kb downloads

...JCavaj Java Decompiler is a free Java-based Java Decompiler. It reconstructs the original source code from...a compiled binary CLASS file. You can decompile java applets, jar and zip files producing accurate java...source code. JCavaj runs on any platform with Java Runtime Environment 1.4 or higher installed....
 
engineersureshotdecompilerjavarecoverdisassemblerdecafejarjcavajfilebinarysourcereverseappletclasszip
Java Launcher

Freeware by SyncEdit
75 x 1536Kb downloads

...Java Launcher is a powerful java tool and contains 9 launching features Java Launcher...features totally. (six features in Explorer) 1. Run Java applications and applets by double-clicking class files 2....View Java codes and class hierarchies (graphic format) by right-clicking...extracting them by right-clicking 4. Compile thousands of Java files by just one right-clicking 5. Execute thousands...
 
launchappletjavarunapplication
Free Vista Files award
...intranet pages & applications. Enabling web authors & Java developers to easily build and publish dynamic interactive...feature and enable you to implement both the applets and servlets quickly and easily. The applets and...Data Sources (Files, Databases, Scripts/Server processes, HTML parameters). JavaScript interaction. Printer Friendly Labels On/Off, Font and Color...
 
graphingpie chartgraph and chartline graphchartingbar
Apycom Java Menus and Buttons

Shareware by Apycom Software
20 x 2132Kb downloads

Free Vista Files award
...Apycom Java Menus and Buttons is a versatile, ready-made solution...and appearance according to your requirements. Based on Java technology, Apycom Java Menus and Buttons possess several...You don`t need any in-depth knowledge of html, javascript or java to develop web menus with Apycom...Java Menus and Buttons. The package has Apycom Applets Tuner, an easy-to-use GUI wizard that gives you...
 
apmenudrop-downbuttondhtmlsourcepulldownappletbarwebsitenavigationpopupjavascript
Anti-Trojan Shield

Shareware by ATShield Ltd.
57 x 6366Kb downloads

...Trojans, worms, viruses, backdoors, malicious ActiveX controls, and Java applets. It efficiently scans, detects, and removes malicious...
 
trojanremovervirusremovertrojankillertrojanscannertrojancleaneranti-trojantrojanhorsedetectortrojanfinderanti-virustrojandetectiontrojanshield
...contain non-HTML elements. The Plugin supports Flash applets, Java applets, Movie Player Applets, ActiveX, and all other...
 
fillerappletscomponentsurfingwshtestingautocompletewebrecorderscriptinghtmlbatchactivexjavaautomateuploadrediarobotautomationcacheflashpopupagent
TracePlus Web Detective (Standard Edition)

Shareware by SST Incorporated
23 x 6706Kb downloads

Free Vista Files award
...Understands SOAP, WebDAV, DASL, and Delta-V protocols. Supports Java applets, Javascript, and VBScript. Millisecond timing accuracy. Displays...
 
httpanalysistracesslinternetspytooldataperformancedebugtraceplushttpsweb
TracePlus Web Detective (eBusiness Edition)

Shareware by SST Incorporated
21 x 8756Kb downloads

Free Vista Files award
...object request and response headers. Supports communications via Java applets, Javascript, and VBScript. Microsecond timing accuracy. Graphical...
 
debugtracespyhttpwebrtsptoolperformanceanalysisinternettraceplusssl
Security Zone Manager

Shareware by Plaxoft GmbH
37 x 1810Kb downloads

...even automatic font installation, new .NET components or Java applets can be easily avoided. Of course, once you...
 
internetmicrosoftrestrictedsecurityprivacyspeedtrustedonlinesiteszones
...Eltima Java Components greatly extend the set of components available...Based on standard components, this collection supports all Java Look and Feel such as Windows, Motif, Macintosh,...fields, and more. You may easily integrate Eltima Java Components into your own Java applications or applets....
 
java componentsjava developmentjava softwarejava swing components libraryjava gui builderjava programming
Free Vista Files award
...recorded into an Internet macro. Support for FLASH, JAVA and Silverlight applets and web site response time...
 
simulatetestingautocompletesilverlightautomaterecorderfirefoxwebagentuploadschedulerrobotcomponentform fillerscriptingperformancejavaautomationappletsflashinternetbatch