1 2 3 4 5 6 7 8 9 ... 55 56 57 58 59 60 61 62 63 64

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...in the forms of: Inline videos, Background sounds, JAVA Applets, Animated gif files, Macromedia Flash movies. Many...
interactive videofull-screen with video adsvideo pop-up stoperstop flashvideo pop blockthe video commercialflash animation stoppervideo pop killervideo popup blockstop video popupblock flashvideo popup stopper
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...Integration Monitoring, WebSphere Monitoring, J2EE Web Transactions and Java Runtime. Database Management feature accelerates the detection, diagnosis,...consoles and SNMP Consoles and to monitor your Java applications or other applications that expose management information...
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
InstantCharts Messenger for Traders

82 x 2082Kb downloads

...charts. This tool which has been developed in Java can be used on windows, Unix or Linux,...
ConTEXT Editor

Freeware by ConTEXT Project Ltd
95 x 1615Kb downloads

Free Vista Files award
...syntax highlighting for C/C++, Delphi/Pascal, 80x86 assembler, Java, Java Script, Visual Basic, Perl/CGI, HTML, SQL, Python, PHP,...
programmershighlightertext editorcontextdevelopment
Developer Tool Marketplace News Screensaver

Freeware by DevDirect
71 x 674Kb downloads

Free Vista Files award
...Find out about the latest software components and custom controls as they become available using Dev Direct`s Developer Tool Marketplace News screen saver. Essential for all .Net, Java, ActiveX/...
cbdclassutilitycbuilderdotnetvbnetbeansaddinaspnetreusecnetdevelopmentclxvisual basicaddonactivexcodecomponentcomponettoolvisual studiodeveloperobject
RSSOwl - Powerful RSS / RDF / Atom News Feed Reader

Freeware by RSSOwl
125 x 4000Kb downloads

Free Vista Files award
...free RSS / RDF / Atom Newsreader in Java using SWT as fast graphic library. RSS ("Really...
aggregatorfeedaggregatorjavafeedreadereclipserdfopmlopen sourceswtatomportablenews readerrcprssnewsreadersnewsaggregatorfreenews aggregatortraycross platformsynchronizationnewsaggregators
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made that?" Consider the...
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
J2EE Guides

Freeware by ICT eBooks by Yeoh HS
138 x 4163Kb downloads

...Servlet #1 Beginner`s Guide to Using Eclipse for Java Development, a step-by-step illustrated guide. #2 Guide to...

Freeware by BK02
236 x 6Kb downloads

...JCaro - A version of Gomoku game running on mobile...

Freeware by BLITZ-ART
72 x 533Kb downloads

...ColSel is designed especially for webmasters and programmers, but it can be very useful for ordinary users too. It can help with choosing appropriate colors for your desktop or colors...
color pickerfreewarecolsel
Fingerprint SDK

Trial by Griaule Technology
244 x 16598Kb downloads

Free Vista Files award
...use. Sample codes provided; * Support for internet Java applets; * International quality assurance: we were successfully...
software componentbiometricsmicrosoft fingerprint readerjavadelphicrossmatchfingerprint recognitionlibrarysdkuareusoftware development kittesctech bio-isecugen hamsterappletdigital persona

Freeware by Altova, Inc.
74 x 9987Kb downloads

Free Vista Files award
...AltovaXML 2010 is a free XML standards processor that includes the Altova XSLT 1.0 and schema-aware XSLT 2.0 engine, XQuery 1.0 engine, XBRL validator, and XML...
xslt enginexml validating parseropen xml parserxqueryxbrl dimensionsxbrl validatorxml validation
...Design-Side Includes (DSI) is a web content reuser utility intended for owners of web sites with little dynamic content who desire posting regular HTML web pages requiring no server...

Freeware by Quest Software
137 x 11115Kb downloads

...TOAD® empowers developers and DBAs to be more productive by providing an intuitive graphical user interface to Oracle. TOAD is a powerful, low-overhead tool that makes PL/SQL development...
Piracy Tracker

Freeware by Shareware Justice
24 x 97Kb downloads

...Free software code to track illegal registration and usage of your software. The purpose of this software is to give shareware developers an idea of how simple it is to...
password protectlicenselincensinganti crackingregistrationsoftware piracy trackeranti-crackfreesoftware protectioncopy protection
Fantasy Battlefields

Freeware by Farfpeuf
155 x 25792Kb downloads

...Fantasy Battlefields is a free turn-based tactical battle game located in a fantasy universe. Each player leads an army to fight against the armies of virtual ennemies (artificial intelligence)...
warriorsknigthstolkienbarbarianorcwizardsdwarffightfree java gamemagicsworddragongoblinwargamegiantfantasy battlefieldstrollogrefree game
...it at will, even if they have it java script protected ? Wouldn`t you like to do...
search and spytypoebaymisspelled
...100% Free Java Applets ! Real Freeware These products are NOT...following:- Free Scrolling Text Free Tree Menu Free Java Game - Alien War Free Java Game -...
appletsjava appletfree java applet
Free Vista Files award
...supported display types are VGA, X Windows, Windows API and Tektronix. The supported file formats are GKSLIN,...interface (GUI) routines based on Motif and Windows API functions. - Manuals are available in HTML format...
Free Vista Files award
...supported display types are VGA, X Windows, Windows API and Tektronix. The supported file formats are GKSLIN,...interface (GUI) routines based on Motif and Windows API functions. - Manuals are available in HTML format...