1 2 3 4 5 6 7 8 9 ... 76 77 78 79 80 81 82 83 84 85

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
453 x 1719Kb downloads

Free Vista Files award
...live audio, MP3 music and photos over the Internet ! The Internet Broadcasting Server is a software...a potentially large audience, using a standard web server as a bandwidth amplifier. All you need to...start your own Internet broadcast is this program, and the ability to...site. The disk space used in the web server is always less than 5 MB, even if...and music, BS-Tuner has no "Save" feature.
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
Scannet Pro

Shareware by Profiler3d
295 x 11118Kb downloads

...of connections over a number of individual WHOIS servers including the X500 NASA server.The HTTP module offers...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...integration with existing directory services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Paessler URL Recorder

Freeware by Paessler AG
92 x 740Kb downloads

...strings that a user sends to a web server while surfing a sequence of URLs. It works...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Free Download Manager

Freeware by FreeDownloadManager.ORG
1049 x 7039Kb downloads

Free Vista Files award
...files or whole web sites from any remote server via HTTP, HTTPS, FTP and BitTorrent up to...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
FastStats Analyzer Free

Freeware by Mach5 Development
91 x 2851Kb downloads

Free Vista Files award
...Super-fast site log file analysis with SmartDNS lookup. Choose from three licenses: a useful FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest...
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP...relay server and scans your incoming and/or outgoing mail for...set up multiple profiles for POP and SMTP servers and switch between them from the system tray....
 
internetutilitiesmail headermail headers

Freeware by Carson E. White
148 x 26119Kb downloads

...Grids that are all printable. And a free internet version family tree builder at www.winloft.com. Includes conversions...
 
genealogytreedatabasesoftwarefamily
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...your web site. Portello is a plug-in to Internet Explorer that puts your page into an editable...is needed. Since Portello is a plug-in to Internet Explorer, you do not have to keep track...used with any web hotel, no matter what WebServer the web hotel uses. Unlike common CMS tools,...
 
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows combining...avoiding the backscatter problem caused by some mail servers trying to send non-delivery notifcations to forged sender...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
589 x 14208Kb downloads

Free Vista Files award
...Advanced SMTP Server is a system-tray local SMTP server program for Windows that lets you send email...the program can be used as a relay server for sending newsletters, distributing messages to different mailing...can use it instead of your ISP`s SMTP server to increase your security an privacy. Advanced SMTP...and receiving messages can be connected to the server in a very easy way - just by...send messages in a usual manner.
 
smtpmailfreemailingbookemailmassaddressmailere-mailbulkremailerbomber
...integrated solution which allows to control and manage internet access and provides: - all-round internet monitoring; -...sites; - more than 10 reports visually showing internet usage statistics; The "Internet Administrator" software provides the...all-round internet access control and monitoring at the enterprises and...the global network – abusing resources of the Internet on a workplace. "Internet Administrator» controls access to...
 
content filteringweb filteringinternet statisticstraffic controlinternet monitoringinternet access control
FREE CompuSec

Freeware by CE-Infosys Pte Ltd
171 x 20800Kb downloads

Free Vista Files award
...software components such as Identity Management, Encryption of Server Files & Subdirectories – SafeLan, Encryption of individual...
 
secure internet callsencryptscddvd encryptionfree callsdata encryptionauthenticationaccess controlfree computer callstabletprotectionsecure communicationvoipsecurity
DNS4Me

Freeware by RhinoSoft.com
180 x 2715Kb downloads

Free Vista Files award
...that you need to start hosting your own Internet services. When you have a dynamic IP address,...
 
domainddnsdynamic dnsaddressstatic
SimpleDesktop

Freeware by Moog Software
134 x 18000Kb downloads

Free Vista Files award
...allow access in even the most restrictive networks. Server and router IP address upload ensures long term...remote access even on DHCP dynamic-ip internet connections and the browser accessible server allows a...download of a multi-platform client from any standard internet connection. Multi-user sessions with chat, secure file and...demonstrations a dream. User accounts with rich permissions, server side hostname and IP filtering, remote screen scaling..
 
http proxyremote accessremote control softwareremote computer controlremote administrationtelecommutingremote administrator
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...Free SMTP Server is a SMTP server program for Windows that lets you send email...the world and connecting their PCs to different Internet Service Providers in different countries. You can use...it instead of ISP`s SMTP server to increase your security and privacy. Free SMTP...and receiving messages can be connected to the server in a very easy way - by using...send messages in a usual manner.
 
bombersmtpfreemailerbookemailbulkaddressremailermasse-mailmailing
.::Anonymous Guest - Proxy Checker, SOCKS Manager::.

Freeware by SPS-Group
149 x 7034Kb downloads

...It allows you to be connected to the Internet and work with the remote server through a...their type and working speed. Supports interaction with Internet Explorer, Opera, Outlook Express, ICQ and other popular...
 
serverchaintestcheckertoollistprivacymanagerproxyinternethttpsoftwareanonymityconnectprotectionsocks4firewallanonymizerhttpssecuritysocks5
...not recommended if you are running either SQL Server or Internet Information Server (IIS). If you are...
 
tweakswindows
Audio Video IFilter

Freeware by AimingTech Company
75 x 325Kb downloads

...your home collection. With Microsoft Indexing Service under Internet Information Server or with SharePoint Portal the IFilter...
 
ifiltersearchindexingsharepointmp3desktopwmaservicewmv
File Sender

Freeware by Qytec
95 x 1171Kb downloads

...File Sender is an application that provides full interconnection between two computers through network (Internet, Lan, etc..). Includes sharing files (you can also share all hard disks in a very...
 
serverfilessendersharedaudiosharingclient