1 2 3 4 5 6 7 8 9 ... 43 44 45 46 47 48 49 50 51 52

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Mach5 Mailer

Freeware by Mach5 Development
114 x 9854Kb downloads

Free Vista Files award
...of email! Simple, Free, and Effective. Send personalized email messages to customers, from any database source including...TLS/SSL encryption, Port changing allows use on all mail servers. Great for newsletters and announcements! Schedule your...fast multi threaded delivery, then process the return email with ease. Your contacts get a personal message...your database. Includes PopMonger Gold 3.
 
sqle-mailphpmergeattachmentsinfactajavascriptmicrosoftcsvbulkvisualwindowsnewslettermailingsodbcopt-inlisthtmlnotificationworldmailvistaexcelsoftwaremassemailerdatabasecustomizemarketingaccess
...and log network activity of the any applications(browsers, email clients etc.). So what does that mean in...(send mail), NNTP (newsgroups)! It works great with Internet Explorer, Firefox, Outlook, and many more!...
 
proxylogtunnel
...X-Ray is an email header filter and POP/SMTP server switching tool. It...relay server and scans your incoming and/or outgoing mail for user specified mail headers. Once it finds...
 
internetutilitiesmail headermail headers
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...e-mail spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows...wish to provide yourself. Traffic limiting protects your mail service from flooding or directory harvest attacks. Recipient...submitted, avoiding the backscatter problem caused by some mail servers trying to send non-delivery notifcations to forged...admin application.
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
563 x 14208Kb downloads

Free Vista Files award
...server program for Windows that lets you send email messages directly from your computer to recipient mailboxes....Along with a mass mailer the program can be used as a relay...server for sending newsletters, distributing messages to different mailing lists, sending notifications to your customers, as well...security an privacy. Advanced SMTP Server supports all email programs like Outlook Express, Outlook, Eudora, etc. The...
 
smtpmailfreemailingbookemailmassaddressmailere-mailbulkremailerbomber
Free Vista Files award
...connected to a local network and/or to the Internet against any intrusions, attacks, trojans, spyware, and other...and internal threats. R-Firewall also filters out inappropriate Internet pages content and blocks dangerous active components you...may get while browsing over the Internet or receiving e-mail massages. Automatic configuration during setup...allows you securely surf the Internet right after the software installation. Mobile users can...
 
data protectionfirewallonline securitydata securityon-line security
M8 Free Multi Clipboard

Freeware by M8 Software(UK)
106 x 7006Kb downloads

...Alt+PrtScr - To capture an individual graphic from Internet Explorer or AOL, point to the graphic, right...
 
multiclipboardscreen capturemulti-clipboardscreenshotscreen shotmulti clipboard
...allows you to get information on movie from Internet Movie Database or type it by yourself and...Editor has Import function - getting information from Internet Movie Database. You can choose what to import...
 
copyrightfourcc changercatalogtitlesearchdecoderauthoringmeta tagsvideo and audiocodecencodertags editordivx
PC SMS - Outlook SMS

Freeware by ComUnified.com
446 x 5273Kb downloads

...as originator - reply function - works without mail client as well as standalone - Covers more...is not listed and you request service please mail support@comunified.com Full Integration with MS Outlook and MS...information through online archive. Direct access even without mail client through taskbar icon. Send copies of your...
 
windows 2000internationalexpresssmswinxpsimstext messagessend smscomputerwindows 2003text messagingemail-smsdesktopvia outlookcomunifiedwin2kinternet
Subscribe Emails

Freeware by IM-Soft
73 x 609Kb downloads

Free Vista Files award
...Subscribe Emails helps you organize subscription to email mailing lists on Internet websites. It lets you check...POP3 email mailboxes for subscribe or unsubscribe email requests, download email messages with the requests to...your computer, get email addresses and sender names from them and create...emails, you can use them with any bulk mailer to add new subscribers and delete existing subscribers....
 
mailingmassemailaddresse-mailfreemailerbomberremailerbulksmtpbook
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...server program for Windows that lets you send email messages directly from your computer. It`s very simple...the world and connecting their PCs to different Internet Service Providers in different countries. You can use...security and privacy. Free SMTP Server supports all email programs like Outlook Express and Eudora, but best...optimized to work with Outlook Express. The email program you already use for sending and receiving...
 
bombersmtpfreemailerbookemailbulkaddressremailermasse-mailmailing
Email Subscriber Pro

Freeware by Getfreefile
65 x 610Kb downloads

Free Vista Files award
...Email Subscriber Pro is an email utility, which helps you realize subscription to email...mailing lists on Internet websites. It uses POP3 email accounts to receive subscribe and unsubscribe requests from...respondents, extracts email addresses and sender names from email messages on fly, and creates plain-text files with...to subscribe or unsubscribe. The text files with emails can be used with any bulk mailer as...
 
bulkremailerextractemailssmtpe-mailmassmailingpop
1st Email Searcher

Freeware by IM-Soft
84 x 1503Kb downloads

Free Vista Files award
...1st Email Searcher helps you to search for email addresses in files and folders located on a...PC or on the Internet, and place emails to text files. The program lets you find...all email addresses you have on your PC, grab only...of them you need, and place them to mailing list files, which can be used by any...find that it is almost impossible to grab emails from some file formats because you are just...open such files with a text editor.
 
bombermailinge-mailsmtpmaileremailremailerfreeaddressbookmassbulk
TICK

Freeware by Really Effective
127 x 749Kb downloads

...transferred. Uses no runtime files and has POP3 mail checker, finger, ping, web notify tools, popup digital...
 
digital displayfingerlogsinternetpingdialpop3callsnetworkingaddress
Pivo DnsResolver Component

Freeware by Pivo Corporation
56 x 232Kb downloads

...address for each host name, and lists the mail exchange servers accepting e-mail for each domain. The...
 
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
Pivo SMTP Component

Freeware by Pivo Corporation
101 x 810Kb downloads

...Short for Simple Mail Transfer Protocol, a protocol for sending e-mail messages...between servers. Most e-mail systems that send mail over the Internet use SMTP to send messages...is generally used to send messages from a mail client to a mail server. This is why...applications or web pages to create and send email messages over SMTP protocol just in a few...in the HTML format.
 
server componentasp componentasp net componentemail parsersmtpemail addresspop3ping

Freeware by CoronaSoft, Inc.
57 x 3844Kb downloads

...data among all your computers. Synchronize your favorite Internet sites with theBookmarks Synclet. Supports Mozilla Firefox! Also...works with Internet Explorer and Mozilla Suite. With the Contacts Synclet,...
 
data synchronizationdocumentsfastbookmarkscalendarwindowsfilesmaclaptopcell phonepdacontactsrsyncmultiple computers
Ad Nuker Popup Blocker & Spam Filter

Freeware by AdNuker.com
112 x 2668Kb downloads

...gives you control of popup ads. Filtering spam mail with 5 different levels. AD NUKER is embedded...toolbar, Protecting you while you are surfing the internet from annoying ads & banners, You can enable...from being displayed onto your PC, Filtering spam mail with 5 different levels of security, You can...such words are found in your mail, the mail is considered as spam, Lets you determine a...receive any mails.
 
spam blockerstop spamfree popup killerfree popup blockersfree popup stopperspam killerspam filterspam inspectoranti spam software
Rapid-Emailer

Freeware by Absolute Futurity
75 x 3912Kb downloads

...Fast email campaign manager. Anonymous Emailer with a Built-In SMTP Server. Duplicate address removal,...you to put each user info in each email automatically, command Line support. pure header manipulation, very...large email list support, overload protection, creates a failed and...the same email.. Command Line support for sending Email Campaigns. Supports Embedded images. Multiple threads, sending up...to 200 emails at the same time.
 
internet marketingbulk mail softwarepure header manipulationanonymousbuilt-in smtp serverbulk emailerprospect maileremail marketingemail campaign managerfast e-mailercontact managermass emailer