1 2 3 4 5 6 7 8 9 ... 37 38 39 40 41 42 43 44 45 46

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
264 x 11118Kb downloads

...Network Monitor,Intern Firewall.Trace route,Shows release,Lists devices and network services,observing network release,observing all ports,direct access on all network releases in LAN,WAN and Internet....
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
92 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
VoIPerized

Freeware by Jeroen de Kleijn
112 x 316Kb downloads

...VoIPerized is a so called VoIP (Voice over IP) program. VoIPerized enables you to make free audio calls to other people who also run VoIPerized. When making VoIPerized the focus...
 
upnplow latencyspeexinternetcommunicationsvoiperizedconferencevadhigh qualitytelephonyvoice overchattelephonefreewareaudio
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
97 x 15516Kb downloads

Free Vista Files award
...service from flooding or directory harvest attacks. Recipient addresses can be checked while a message is submitted,...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
381 x 14208Kb downloads

Free Vista Files award
...connections, and gets the most out of your Internet connection. Advanced SMTP Server is able to send...of emails per minute with a regular DSL Internet connection. The user interface of the program is...
 
freemailsmtpmailermassbomberemaile-mailbulkbookmailingremaileraddress
Cayman Browser

Freeware by caymanbrowser.com
63 x 1677Kb downloads

...Improve your Internet surfing with this tabbed, innovative Web browser today!...Drag links on pages or other files to address bar for surfing quickly *Voice engines: Reads a...
 
webbrowser
DNS4Me

Freeware by RhinoSoft.com
168 x 2715Kb downloads

Free Vista Files award
...that you need to start hosting your own Internet services. When you have a dynamic IP address,...
 
domainddnsdynamic dnsaddressstatic
SimpleDesktop

Freeware by Moog Software
122 x 18000Kb downloads

Free Vista Files award
...the most restrictive networks. Server and router IP address upload ensures long term remote access even on...DHCP dynamic-ip internet connections and the browser accessible server allows a...download of a multi-platform client from any standard internet connection. Multi-user sessions with chat, secure file and...the full featured web client from any standard internet browser when in restrictive internet cafes....
 
http proxyremote accessremote control softwareremote computer controlremote administrationtelecommutingremote administrator
Subscribe Emails

Freeware by IM-Soft
62 x 609Kb downloads

Free Vista Files award
...you organize subscription to email mailing lists on Internet websites. It lets you check POP3 email mailboxes...with the requests to your computer, get email addresses and sender names from them and create text...
 
mailmailingbomberbulkmassbookmailerremailersmtpe-mailfreeaddress
Free SMTP Server

Freeware by IM-Soft
293 x 619Kb downloads

Free Vista Files award
...the world and connecting their PCs to different Internet Service Providers in different countries. You can use...connections, and gets the most out of your Internet connection. The user interface of the program is...
 
mailingmailerremailerbomberaddressbulksmtpfreebookmasse-mail
1st Email Searcher

Freeware by IM-Soft
72 x 1503Kb downloads

Free Vista Files award
...Email Searcher helps you to search for email addresses in files and folders located on a PC...files. The program lets you find all email addresses you have on your PC, grab only those...
 
bombermailermassaddresse-mailfreebookemailsmtpremailerbulkmailing
Alien IP

Shareware by ArmCode
78 x 16770Kb downloads

...the user just pastes the name or IP address into a drop-down box on the tool bar...address; - Resolve domain names, IP ranges and address lists from files; - Translate IP address into...
 
geowebaddresshostlookuppositionresolvesearch
TICK

Freeware by Really Effective
83 x 749Kb downloads

...notify tools, popup digital display, password database, IP Address finder, context sensitive help and lots more....
 
digital displayfingerlogsinternetpingdialpop3callsnetworkingaddress
BySoft InternetPal

Freeware by BySoft
72 x 892Kb downloads

...InternetPal is 32-bit win95/98/NT/2000/XP program for monitoring Internet connection. Automatically monitors calls and detects connection types....- total download and upload - current IP address - connection speed - program status (online, waiting...
 
online timerinternetcostuploadnetworkchartbysoftconnectionratebandwidthaveragespeedgraphdialuptransfer
BySoft Network Monitor

Freeware by BySoft
109 x 207Kb downloads

...data downloaded - Total data uploaded - IP address - Adapter speed - MTU size - Adapter...type - MAC address - Status - Admin status - many more...
 
uploadaddressfreeonlinetransferratemonitorutilityinternetfreewareconnectionmacspeedbandwidthnetwork
Mihov Picture Downloader

Freeware by Miha Psenica
80 x 376Kb downloads

...several web pages. Just type in the starting address and let this program do the rest. One...
 
mihov picture downloadervideophotosmusicquickpageaudiothumbnailslistslikaminiimagespicturesinternetspletgraphicsfotoweblinked
Pivo DnsResolver Component

Freeware by Pivo Corporation
43 x 232Kb downloads

...the Internet. Most importantly, it provides an IP address for each host name, and lists the mail...while computers and network hardware work with IP addresses to perform tasks such as addressing and routing,...
 
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
Pivo Ping Component

Freeware by Pivo Corporation
56 x 232Kb downloads

...you to effortless enable your applications to send Internet Control Message Protocol (Ping/ICMP) packets in .NET. Programmatically...
 
net componentasp componentemail addressserver componentpingpop3email parserasp net component
Pivo SMTP Component

Freeware by Pivo Corporation
89 x 810Kb downloads

...Most e-mail systems that send mail over the Internet use SMTP to send messages from one server...Smtp Component can send email to any email address with or without smtp server as parameter. Email...
 
server componentasp componentasp net componentemail parsersmtpemail addresspop3ping
Computer History Viewer

Freeware by Elongsoft Software
211 x 384Kb downloads

...Every time you surf the Internet or use other applications on your PC, traces...time that you type a URL in the address bar or click on a link in Internet...Explorer browser, the URL address is automatically added to the history index file.With...history, open/save history, recent documents, User Assist History, Internet Explorer`s cache, cookies, history, visited URLs, typed URLs,...
 
windows historyinternet explorer historyweb historyview historybrowser historyhistory viewercomputer history