1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Sort by : ReleasedNameDownloadsAddedRatingRelevance
CD-Start

Freeware by Kroenig dataDesign
47 x 3295Kb downloads

...The cdstart.htm will then be rendered by the integrated browser-engine of cdstart.exe. Your hyperlinks in the html...
 
quickstartercd-starter
The Mutant

Freeware by Admin Department
18 x 5957Kb downloads

...The Mutant is an integrated software system that can act as a relational...Application modifications are as easy as manipulating a browser page. Esthetic modifications can be tailored to the...
 
freeware
Crawler Parental Control

Freeware by CRAWLER, LLC
100 x 7560Kb downloads

Free Vista Files award
...from Google, Yahoo! and MSN. Crawler Toolbar features integrated Web Security Guard alerts to help prevent you...you can access the record from any Web browser at any time. Get a comprehensive control of...
 
content controlcomputer protectioninternet toolstime controlfreewareparental controlfree softwareemail notificatorsecurityactivity control
dbQwikSite Personal Plus Edition

Freeware by Gerald Enright
19 x 13452Kb downloads

...database (ADO connection) -Seamless local testing in your browser -Integrated web site publishing -Sort, Search and filter...Down Lists -Create E-Mail Pages containing data -Fully integrated security -Integrated Visual Query Builder to select database...pages -Preview output in dbQwikSite or in your Browser -Generate picture links to data from your database...
 
freeware
...entry tools enable Atlas users to use Internet browsers to run the browser-based timesheet entry applications. With...on the client PC is a standard web browser and Atlas users can fill in their timesheets...from anywhere using any platform. The integrated Web Server Control captures all information and updates...
 
time sheetexpensestime and attendancetimekeeping softwareweb timesheetspayrolltime trackingproject trackingproject managementtimesheet softwareexpense reportingbilling
Sleep Moon Xpress

Freeware by Reohix
23 x 12834Kb downloads

...you have a Bluetooth enabled phone with an integrated camera (you can also do without a camera)...
 
automation toolsleep moon xpress softwaresleep moon xpress reohixreohix sleep moon xpressremote launchremote turn offremote control computerauto shutdown computer
StampManage Stamp Collecting Software

Demo by Liberty Street Software
13 x 309149Kb downloads

...the industry standard Scott numbering system. Use the integrated Report Designer to create your own reports. Reports...
 
stamp collection softwarephilatelicstamp collector programsstamp collecting softwarescott stampscott catalog
Search Engine Commando

Shareware by CommandoWare, LLC
13 x 6949Kb downloads

...alert. You`ll never lose a domain name again! Integrated scheduling automatically runs the Reporting, Submission and Domain...
 
rankdomain namepromotionmetasubmitwolfseosubmissioncompetitionpagesoptimizationplacementtagsdoorwaytraffictopdogcommandosearch enginelistedwhoismarketingwebpositionadvertiseurl
m9P Zipper XT

Shareware by mental9Production
23 x 4326Kb downloads

...or type. Creates detailed report of zipping operations. integrated text editor, web browser, media player, & pic...
 
unzipdecompress
ABF Internet Explorer Tools

Shareware by ABF software, Inc.
14 x 1094Kb downloads

Free Vista Files award
...popup windows or refresh any web page ignoring browser cache; people with poor eyesight will find an...
 
toolsblockabfexplorermagnifiermagnifyimagessavewindowsinternetrefreshbrowserutilitespop-ups
...styles and layouts. - ASP.NET and .NET: Closely integrated with the ASP.NET, generating Flash charts directly to...
 
linerich mediagraphicsmultimediaplotsinteractive chartsspreadsheet importpresentationcolumnflash chartsdrill-down chartsgraphsswfdynamic chartschartinganimated charts
m9P Zipper X

Shareware by mental9Production
21 x 4423Kb downloads

...detailed reports of zipping operations. It includes an integrated text editor, web browser, and media player. m9P...
 
unzipdecompress
Rapid CSS Editor 2014

Shareware by Blumentals Software
21 x 18606Kb downloads

Free Vista Files award
...CSS prefixer and built-in instant multi-browser preview with integrated X-Ray. Includes full support for the latest HTML5...
 
style sheetsrapid cssvalidatehtml editorcss editorxhtml editor
QSyncFTP

Shareware by QUESTER
10 x 774Kb downloads

...automatically to one or more FTP servers. The integrated FTP client allows easy manual upload, it displays...you access to old files. (f) Interactive FTP browser - QSyncFTP includes its own two-pane FTP browser...
 
web master toolftp syncweb editorweb managementweb hostingftp uploadweb publishingftp synchronizationweb softwareweb actualizationwebsite promotionftp programftp-serverweb updater

Commercial by WebAsyst LLC
22 x 3079Kb downloads

...PRO features plus exclusive advantages such as: - Integrated with Google Checkout - Support for complex (configurable)...(search by custom parameters) - Order SMS-notifications - Integrated with Google Analytics - Support for non tangible...
 
ecommerce shopping cartshop scriptturnkey ecommercephp shopping cart
Free Vista Files award
...edit and manage Windows services. FireDaemon Pro, when integrated with FireDaemon Fusion facilitates the control and management...
 
schedulinggracefuldetectionflapwindowsprogramdirectorydebugmonitorfiredaemonexecutablecpubindingstartstopdependenciescapturevariableaffinitystdoutscriptenvironmentservicecrashfailstderrloggingactiverunshutdownapplication
dbQwikReport OnTime Designer Pack

Shareware by TheDevShop Ltd.
13 x 10171Kb downloads

...to your preferred language, Publish your reports using integrated FTP Tool, Create report that work using ASP...
 
databaseweb reportmysqlaccessreportingphpcode generatorasp
WeBuilder 2014

Shareware by Blumentals Software
25 x 20154Kb downloads

Free Vista Files award
...SSI code faster and easier than ever, while integrated tools enable you to validate, reuse, navigate and...
 
unicodehtmlxhtml editorphp editorjavascript editorutf-8csscss editorvalidate
XSpy Shield Gold

Shareware by Elcor Software
18 x 3647Kb downloads

...protect your PC against well-known Keyloggers, x*x-Dialers, Trojans, Browser Hijackers and other datamining software. If you don`t...detected critical object. The application comes with the integrated real-time protection tool called XSpy Monitor. This effective...works in background monitoring running processes, cookies and browser settings. All tests showed that XSpy Monitor detects...most parasites upon their installation.
 
dialerspluginskeyloggersvirusesbrowser hijackerstrojansnetwork managementadwaregeneric malwareremote adminstration toolswormsspyware
m9P Editor Plus

Shareware by mental9Production
12 x 12056Kb downloads

...a clickable link. The link will launch an integrated web browser. E-mail addresses will be identified when...
 
writerderteditorrich textttstext speechpdfrtfhtml