1 2 3 4 5 6 7 8 9 ... 41 42 43 44 45 46 47 48 49 50

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...SQLWriter is a powerful SQL script editor for all database developers and database administrators. It supports ACCESS, SQL SERVER, ORACLE, DB2, SYBASE, MYSQL, FIREBIRD and others. In addition, it also...
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
SID DVD-Video Image Extractor

Freeware by SoundInDepth.com
48 x 12128Kb downloads

...Free DVD Image Extractor is an easy tool which enables you...DVD-Videos and capture snapshots . It supports three tools for capturing snapshots which are Single snapshot ,...composed of three main parts: Media Actions, Media Tools and the Main Menu Bar. In Media Actions...shows the progress of the movie.In the Media Tools part, you will find the functionality we provided...you will start to capture a sequence of images until you click it again. You can use..
 
rewindpauseturningmillisecondssingle snapshotonoffaudiodvd-videocontinuous snapshotssequencetimed snapshotsstopimagescapturefast forwardportionplayextractor
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in validation. Rookies, get...why the HTML Editor comes with three different tools to correct human error and ensure that you`re...in HTML 4.01, XHTML 1.0, or HTML5, these tools have you covered....
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Excel Invoice Template

Freeware by Office-Kit.com
767 x 40Kb downloads

...styles, colors of the template, by using various tools provided by Excel. The invoice template shows quantity,...You can even provide or insert a logo image for your invoice form to make your invoices...
 
invoice softwareinvoice templateblank invoicebillinginvoice programcreate invoicefree invoicefree invoice templateinvoice form
TwistedBrush Free

Freeware by Pixarra
177 x 1792Kb downloads

...media such as pastels or colored pencils, specialized tools like masking, themes like the Landscape ArtSets or...TwistedBrush is easy to use, but the powerful tools are there for those inclined. Tools such as...
 
acrylicoilpaintcontebookphotofeltartistpicturecharcoalcrayonpaperstrokewatermarkerclonebrushcanvaschalknaturalsketchlayerpastelcolorpencilblendimagepaddrawgraphic
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...user friendly features to display your 3D and images files. 3DBrowser recognizes more than 60 images, videos,...need such the width and height of your images or the title and the length of your...Mesh subdivision - Slides show >> Open your images or your videos in the built-in viewer. Use...one of these many available tools to edit your images: - Crop & resize...- Image conversion - Rotation - Colors adjustment - Image...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
MobilePanda MobilePhoto

Freeware by mobilepanda
271 x 1300Kb downloads

...PDA, or any mobile device. Work with any image local, and use the wide selection of easy-to-use...image enhancement tools that will turn ordinary photographs into memorable ones....
 
mobile wallpapermobile photocellphone photocell phone wallpaper
...have also added the following Features: eBay Spy Tools Description Grabber eBay Power Search Links to Free...item description Revise your items Change the Gallery Image Cancel Bids on your Listing End your Listing...
 
ebaymisspelledtyposearch toolbar
CBN Selector

Commercial by CBN Systems
55 x 10265Kb downloads

Free Vista Files award
...CBN Selector maintains amazing photo-realism of your digital image even while re-coloring - preserving textures, subtle shadows...
 
color harmonycolor schemeimagingvisualizerecolorcbngraphicsdigital colorvirtualre-colourpaint colorsre-colorvisualizationdiyrecolourstuccodesigndecorate
VCW VicMan`s Photo Editor

Freeware by VicMan Software
168 x 5010Kb downloads

...with all PRO features. With this free easy-to-use image editor, you can turn your snapshots into works...of art, as well as draw your own images using its built-in image enhancement functions. Select a...any picture. The program supports more than 20 image formats. The distortion tools offer more than a...
 
graphicsresizebrushphoto effectfish eyephoto suittextfree photo editortwirlimprove imagedrawedit photophoto filteredit imagecorrect imagefree image editorcroppencilcorrect color
Raster To Vector Converter

Freeware by S&G Team
108 x 10223Kb downloads

...absolutely free solution for digitizing vector data from image sources. It combines the power of outline vectorizing...and other similar images. Palette and True Color images are supported in BMP, JPG and GIF formats....ultimate platform for industry-oriented solutions and has different tools to get a perfect set of vector data...
 
vectorrasterr2vanalyzedrawingdesignillustrationgraphics
HashCalc

Freeware by SlavaSoft Inc.
50 x 468Kb downloads

Free Vista Files award
...Free calculator to compute multiple hashes, checksums and HMACs for files, text and hex strings. It allows to calculate hash (message digest), checksum and HMAC values based on the most...
 
checkerfilealgorithmveriifyingtesterchecksumcheckingpasswordkeymessageencryption128hashhmacverifiercalculationdigestgeneratorcrcdataverifycalculatetestingauthenticationbitcomparecomparationcomparing
Adds for Outlook

Freeware by Brigsoft
31 x 434Kb downloads

...html format you often need to wait while images are loaded. Adds for Outlook can delete such...
 
hidebuttonhtmlschedulerutilitysecuritysystrayrestoreicontoolsexitingoutlookalarm clockadd-onimagesystem trayutilitiesminimizemicrosoftwindowsadd-inplug-in
AWicons Lite

Freeware by Lokas Software
102 x 3520Kb downloads

...graphical user interface is iconic graphics. A small image that takes only a couple dozens of pixels...paragraph of text. Due to the nature of imagery perception icons create the strongest associations in human...an unbeatable price you can purchase all the tools you need to create graphically rich icons in...an icon drawing suite AWicons offers popular drawing tools (pen, line, ellipse, polygon, text, colors replace, etc.)...
 
desktopawiconseditortoolslokasgraphicscursors
J2K Converter

Freeware by Anything3D Corp.
45 x 1806Kb downloads

...With the help of this original freeware you can converse a number of pictures of JPG 2000 format to BMP format. You can also sort the pictures and save the...
 
jpeg 2000image compressingimage compressiongraphics tools
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...It has never been easier to view images and pictures on your computer whether your images...solution for anything from professional presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of...integrated MediaView component seamlessly allows you to view images in the right-click menu of the Microsoft Windows®...shell. For uncomplicated image viewing, PictureViewer .EXE provides a comprehensive slideshow utility...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Picture Studio .EXE Professional

Freeware by SoftTech InterCorp
53 x 3076Kb downloads

...it comes time to share or publish your images via the web you may need to consider...as sharpening, or auto contrast – The integrated Image Converter .EXE makes this process quick, simple and...precise. Looking to fancy up images even more? You can use the included Image...Merger .EXE to superimpose images together, creating a unique style for your photos!...Studio .
 
gifbmpplaylistpicturedisplaywallpapergraphicsjpgslideshowphotoimageviewertif
IconArt

Freeware by ConWare
103 x 550Kb downloads

...icon or cursor from scratch using all common tools or to import an image to turn into...paint but has a large number of extra tools designed for the publication of both static &...
 
editiconarticonsdesktopcursorscreateconwaregraphics
TFTP Server

Freeware by SolarWinds
1310 x 6252Kb downloads

...server commonly used to upload and download executable images and configurations to routers and switches. The free...– enables you to concurrently upload and download images from multiple network devices. This powerful feature saves...Server is just one of the 49 powerful tools included in SolarWinds` award-winning Engineer`s Toolset. This robust...collection of desktop tools delivers the network management, monitoring, and troubleshooting tools...
 
networkpingfreetoolsfirmwaresubnettftpsolarwindsciscotracerouteserverimageaddress
Binary Viewer

Freeware by ProXoft L.L.C.
71 x 1491Kb downloads

...display of file contents there are two additional tools helping to interpret the file: 1. Visualizer which...the oft of image. Every dot of the image corresponds to the value within the file and...
 
executableeditdecimalbinary viewerhistogramhexadsoctalreverse engineeringfreewarevisual file representationutilitybinary fileeditingalternate data streamhexadecimalunicode