1 2 3 4 5 6 7 8 9 ... 20 21 22 23 24 25 26 27 28 29

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SQLWriter

Shareware by ljcsoftdev
84 x 2012Kb downloads

Free Vista Files award
...SQLWriter is a powerful SQL script editor for all database developers and database administrators. It supports ACCESS, SQL SERVER, ORACLE, DB2, SYBASE, MYSQL, FIREBIRD and others. In addition, it also...
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
...thread ID, priority and creation times, base priority, image file path, module file path, app instance handle,...be analyzed later; (5)Retrieves command line, environment strings, image file path for a program by simply pointing...it; (6)Extracts dynamic resources such as icons, bitmaps, image lists, enhanced metafiles, fonts, window properties from controls...
 
titlesmemory leakscontrolswinidstylesclasseswindow handlehwndresource leaksdebugging
SizeMe

Freeware by Lars Werner
114 x 1333Kb downloads

...result on each disc. NEW features! * Context menu handle on every item * Copy, move and...disc * Customizes as you select * Context menu handling by right clicking on a drive anywhere...hierarchy or goto the parent directory. A context menu is also added on each disc. You can...
 
maximizeisomusicplayerthumbzipmp3imagesizeoutputdvd
SID DVD-Video Image Extractor

Freeware by SoundInDepth.com
41 x 12128Kb downloads

...Free DVD Image Extractor is an easy tool which enables you...parts: Media Actions, Media Tools and the Main Menu Bar. In Media Actions you will see a...you will start to capture a sequence of images until you click it again. You can use...the default without showing the dialog again. DVD-Video Image Extractor will then capture a snapshot automatically and...for activating the full screen display. The Main Menu Bar consists of the File Menu: In this...
 
rewindpauseturningmillisecondssingle snapshotonoffaudiodvd-videocontinuous snapshotssequencetimed snapshotsstopimagescapturefast forwardportionplayextractor
ObjectDock

Freeware by Stardock Systems
417 x 12232Kb downloads

Free Vista Files award
...Newer features include Windows Vista compatibility, a new image searching feature, .DockZip support, a new algorithm for...changed default look and icons, a new start menu docklet, options for dock placement that is completely...
 
windowblindslauncherstardock
FirmTools ShellExtension

Freeware by FirmTools
79 x 520Kb downloads

...it will add three new options to your menu when you right click on a picture file:...dialog. Clicking on the thumbnail will open the image in the default program. For printing, there are...no options, you get a centered image with the file path at the top of...
 
picture filecontext menuquick convertthumbnail preview
FreeCommander

Freeware by Marek Jasinski
216 x 2387Kb downloads

Free Vista Files award
...to view files in hex, binary, text or image format * File viewer inside archives too *...to system folders, control panel, desktop and start menu * Copy, move, delete, rename files and folders...* File splitting * File properties and context menu * Calculation of folder size * Folder comparison...
 
rarfreefilemanagercomparefoldernortonlistcommanderzipwindowssynchroniseunpackcabfavorites
Bootpart

Freeware by Gilles Vollant
84 x 25Kb downloads

Free Vista Files award
...one partition in the Windows NT multi boot menu (by samples, OS/2 boot manager or Linux partition)....creates a 512 bytes file which contains an image of a boot sector that loads the boot...
 
mbrmulti-bootbootinibootpart
Windows File Explorer

Freeware by FreeSoft Labs
79 x 2640Kb downloads

...options that Microsoft`s Windows Explorer is missing like image preview and it has two fixed file views...file manager! Features: Support Microsoft`s Windows Explorer context menu (if you install a program like winrar that...it will be added to Windows File Explorer menus too. Support Thumbnail views of images. Supports Drag...like subdirectories. (if supported by OS) Built in image file viewer (supports bmp, jpeg, png, gif, tiff,...
 
viewerutilitypowerdeskwindowsnortonsalamandersystemzipexplorermanagerthumbnailbrowsercomandercommanderfilemanager
Weaverslave

Freeware by Thomas Weinert
11 x 2189Kb downloads

Free Vista Files award
...can insert HTMLtags or other text snippets from menu or a tool window. The text snippets can...entites and a taginspector are avaliable. File an image browser are integrated, too. The editor has syntax...
 
javascriptdhtmlsourcephpxhtmlsqleditorxml
Easy Thumbnails

Freeware by Fookes Software
92 x 1038Kb downloads

Free Vista Files award
...a handy freeware utility for creating accurate thumbnail images and scaled-down/up copies from a wide range of...interface makes it a snap to find your images and select them for processing individually, in groups,...folders, using a simple file selector and built-in image viewer. You can use slider controls to rotate...possible results. You can convert small batches of images inside Windows Explorer from the File menu or...
 
batch resizingcreatescaledownloadablethumb nailsthumbslanczos3freewarejpeggeneratethumbnailspicturesresamplingjpgeasylosslessimagesresizethumnailsdigitalphotos
ActualDoc Standard

Freeware by Flexigen Software
15 x 4004Kb downloads

...put it? - You need to copy an image from a document that you created yesterday? -...
 
jpeg viewernfo viewererase historydocument management windowactualdoctif viewermrujpg viewerclear document recenttga viewerpsd viewermagic recent documentstiff viewerdocument history menu start
Menu Builder OS

Freeware by ArtistScope
23 x 74Kb downloads

...used for navigation buttons or to display an image at any size. It was designed to overcome...with using JavaScripts for rollovers in page inserts. Menus need to be fast loading, retrievable from cache,...be able to be placed into pages efficiently. Menu Builder enjoys the same rollover functions as JavaScript,...pages. To increase your directory, simply paste another Menu Builder to the page. There is no limit...text, plays sounds and is clickable for linking.
 
linkappletimagenavigaterollovermenusoundswapbutton
Orneta Paint for Smartphone 2002

Freeware by Orneta
82 x 128Kb downloads

...taken from your phone`s camera. Create or Edit Image Files You can even use Orneta Paint to...can be used to select sections of an image for editing purposes. Cut areas to move it...
 
smartphonepaintphotojpegbitmapdigitalwindowseditormobileviewerimage
VCD Menu Lite

Freeware by Briggs Softworks
62 x 831Kb downloads

Free Vista Files award
...VCD Menu Lite is a free Video CD / DVD...video toolkit and quickly produce simple but attractive menus as front-ends for your VCD / DVD movie...presentations. Pick your colors, type in titles and menu captions, grab the frames from your movie clips,...authoring program such as DVDAuthorGUI to convert your menu image into an MPEG still....
 
dvdtitleauthoringsvcdmovievcd menu litevideo
Automatic Wallpaper Changer

Shareware by Steve Murphy Software
1051 x 12856Kb downloads

...to be a one stop shop for displaying images on your desktop wallpaper.You can simply display you...Desktop or create spectacular wallpapers by merging your images with the background of your choice using powerful...AWC will create a list of all the images contained in them, randomly select one and format...combination of the many available options. The displayed image can be resized for the best fit to...of the edges.
 
positiongraphicsmultiple monitorsfilterwallpaperautomaticpicturesdesktopwebcamtiledchanger
RIS Menu Editor v1.0

Freeware by emBoot Incorporated
44 x 460Kb downloads

...from 3Com, emBoot now offers the emBoot RIS Menu Editor, and takes (Microsoft`s) RIS beyond it`s out-of-the-box...capabilities. emBoot`s RIS Menu Editor extends the functionality of RIS by allowing...network administrators to add menus and options to the RIS Client Installation Wizard,...and to create boot images. These menus and options can be used to deliver network...boot images that offer maintenance utilities, such as BIOS upgrades...
 
dhcppxeremote installation servicestcpiprismanaged bootnetwork bootingdesktop managementdeploymenttotal cost ownershipremote bootboot romsbootpboot servicespre-oswfmwired for managementpreboottftp
Picture Viewer .EXE

Shareware by SoftTech InterCorp
52 x 2377Kb downloads

...It has never been easier to view images and pictures on your computer whether your images...solution for anything from professional presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of...integrated MediaView component seamlessly allows you to view images in the right-click menu of the Microsoft Windows®...shell. For uncomplicated image viewing, PictureViewer .EXE provides a comprehensive slideshow utility...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Menu Builder

Freeware by ArtistScope
14 x 91Kb downloads

...used for navigation buttons or to display an image at any size. It was designed to overcome...with using JavaScripts for rollovers in page inserts. Menus need to be fast loading, retrievable from cache,...be able to be placed into pages efficiently. Menu Builder enjoys the same rollover functions as JavaScript,...pages. To increase your directory, simply paste another Menu Builder to the page. There is no limit...text, plays sounds and is clickable for linking.
 
menulinkswapimagerolloverappletbuttonsoundnavigate
ClipSize

Freeware by DataMystic
25 x 612Kb downloads

...limited memory or with memory-intensive applications such as image editing or desktop publishing. Most MicroSoft applications give...A right click on the icon displays a menu that allows you to clear the clipboard, view...
 
clipsizeclipboard