1 2 3 4 5 6 7 8 9 10 11 12 ... 46 47 48 49 50 51 52 53 54 55

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ABF Slide Show Screen Saver

Shareware by ABF software, Inc.
17 x 939Kb downloads

...Saver is a screen saver with cool looking effects and abilities to show pictures ether from local...interval of changing, type of effect, background color, image stretching and other options. ABF Slide Show Screen...Saver supports more then 130 amazing slide effects for any test, also a random effects feature...
 
abfimagevieweffectpicturegallerysaverfoldercoolwebamazingphotoshowslidescreen
Acme Photo ScreenSaver Maker

Shareware by Acme Photo Software
55 x 1835Kb downloads

Free Vista Files award
...It is easy to build an excellent cool effect screen saver with your own photos and music...this program: • build screen savers with cool effects easily and fast • fully integrated workspace with...random order • customizable screen saver background and image mask • static caption for each photo •...dynamically • 23 kinds of cool smooth transition effect • 10 kinds of dynamic headline effect •...
 
screen saver softwarescreen saver makerscreensaver maker
Flowers and Plants ScreenSaver

Freeware by free-slideshow.com
5 x 3754Kb downloads

...We truly live in a world full of wonders. Often we just do not see it absorbed in our imaginary world of troubles and dreams. But there...
 
wintercolorrainforestwondersrivertulipshotwatersnoweffectsiberiadesktoptaigalifescreenamazinglivingsavervalleytruedroppicturegreenmountainplantsimagecharmingflowersbeautifulnature
Stereogram Explorer

Shareware by olej
13 x 1700Kb downloads

...high-quality hidden 3D graphics, also known as Single Image Random Dot Stereograms (SIRDS) or Single Image Stereograms...from 3D model Export to BMP and JPG image Hidden-surface removal Complete absence of artifacts (ghosts) Really...smooth 3D images (oversampling up to 8 levels) Blur effect (3...levels) Automatic texture and depth image bilinear resizing All options are configurable Supported image...
 
imagetexturemaprendersirdsdepthmodelstereogramsexplorersisgraphics
3D Maker

Shareware by Lokas Software
65 x 510Kb downloads

...Multiple studies indicate that 3D elements of graphical image are perceived better thus making it easier for...
 
photoshoppluginpaint shop profilterartisticeffectplug-incorel photo-paint
Artistic Effects

Demo by Lokas Software
63 x 981Kb downloads

Free Vista Files award
...is! Introducing Artistic Effects! A whole collection of image filters that make up professional computer artist toolbox....graphically rich artwork right away. Among the professional effects included in this plug-in package are: Aqua, Chrome,...Ice, Snow, Metal, Plastic, Gel, Smoke, Cotton. Each effect is built on high precision mathematical model ensuring...greatest level of quality when applying effects.
 
filterplug-inaquaphotoshoppaint shop proartisticmetalchromeplugineffectcorel photo-paintplastic
DB Audio Mixer & Editor

Shareware by DigitalBorneo.com
19 x 7704Kb downloads

...music recording, playing, editing, mixing, applying various audio effects and filters, format conversion and more. If you`re...your own audio book, background music or sound effect for your drama class, then this tool is...then mix, edit, add special sound and filter effects to your music! You can even rip tracks...operations for each files. View a graphical waveform image or a spectral view of an audio file....
 
mixingformat conversionmixerdisplaysspectral viewwaveform imageaudio datafiltersaudio files editormusicsoundeditingfrequency analyisisapplyingplayingvarious audio effectsrecording
...Graphics Processor 1.9 is a must have image processing component. Based on the GDI+ graphics library...Processor 1.9 integrates important features—raster object, drawing objects, image collection and encoding—providing a solid foundation on which...you can build powerful image processing applications that will support all your needs,...even layers. Create exceptional imagery with quick access to your file data. Save...
 
sharpeneffectsgraphicsgifrotatetiffformatblurconvertprocessingimagedisplaybmpresizejpeg
AV Bros. Puzzle Pro for Windows

Demo by AV Bros.
21 x 4417Kb downloads

Free Vista Files award
...compatible hosts, such as Adobe Photoshop Elements, Adobe Image Ready, Adobe Fireworks (formerly Macromedia Fireworks), Corel Paint...is targeted to help you create jigsaw puzzle effects of various types, but thanks to its superb...produces a whole bunch of different high quality image effects. AV Bros. Puzzle Pro 3.1 provides you...of puzzle`s shapes, a large number of built-in effects for modifying the content of puzzle`s pieces, a...
 
jig-sawpuzzlefilterplug-injigsaweffectphotoshop filter8bfphotoshop pluginphotoshop plug-inphotoimpactphotopaintpspphotoshop effect
AVD Graphic Studio

Shareware by AVLAN Design
13 x 4003Kb downloads

...Looking for an image processor that would offer advanced options and features,...It provides over 20 tools to work with images – cropping, resizing, rotating, bump mapping, histogram equalization,...mirroring (horizontal and vertical), special effects filters and many more handy options for image...digital artists. For instance, AVD Graphic Studio acquires images from TWAIN scanners and can be used to...
 
animatedgifmultimediaslide showgraphic editormaskscanningsampleconvertertransition effectsharewaremultipageframempgdrawingimagevideograbbermpegtiffslicewebdesignanimation
AVD Slide Show

Freeware by AVLAN Design
19 x 1318Kb downloads

...can use to easily view a sequence of images as a slide show, each image being shown...how long to display each picture, select transition effects and then sit back and watch. If a...
 
showtransitioneffectbackgrounddigitalphotodurationrandomreverseexportplayscreenslideimage
...this studio you can crop and resize any image to fit on your PocketPC or other mobile...items displayed on the Today screen. Set your image to be transparent, even select the color you...
 
wincecell phonewirelesshandhelddevicethememobilepocketpcwindowswallpaperppc
PhotoRetouch

Demo by CAD-KAS GbR
20 x 632Kb downloads

Free Vista Files award
...out parts out it, optimize the colors, use effect filters, remove objects with the clone brush. You...file formats, scan new photos, manipulate pics, use effects filters and than save and print out the...
 
photoretoucheditcad-kaspicturethumbnailimageviewer
ANVSOFT 3GP Photo Slideshow

Shareware by ANVSOFT Inc.
20 x 6088Kb downloads

...transition effects. It supports Over 260 amazing transition effects with Pan & Zoom effect....
 
3gp photo slidemobile photo3gp imagepmp3gp picturempeg-43gp photo slideshowanvsoftphoto cellular phoneslide showmp4
MemoriesOnTV

Shareware by CodeJam
50 x 7609Kb downloads

Free Vista Files award
...from your photos and video clips. All common image and video formats such as MOV, MPG, AVI...CD-R(W) and DVD+-R(W). You can apply many visual effects to your pictures, including documentary style Ken-Burns Pan...
 
slideshowvcdphoto archivedigital photovideodvdslide showmpegpicture
AmphiSoft plugins

Shareware by AmphiSoft
33 x 755Kb downloads

Free Vista Files award
...10 Photoshop-compatible plugins for special effects and photo retouch. Effects include painterly look (watercolor...processing for seamless tiles. Fully compatible with various image editors, from Adobe, Corel and Ulead image editors...
 
screenguillochewatercolorirfanjascfireworksadobeplug-inengravingphoto impactbrushpainterlyplugindryphotopaintpaintshop prophotoshophalftonelinefiltereffectmacromediaimagecorelmetallic
Advanced Screensaver Maker

Shareware by LansSoft Software
13 x 3101Kb downloads

...you create screen savers based on Shockwave Flash, Image Slide Show, animations (FLC), Webpage and Movie (Quick...etc.) Define each scene`s caption Support drop shadow effect Readme and License text can now be in...other programs Choose font color, type, size, and effect for the global scene`s captions Project Save/Load -...saver project. All settings are modifiable Advanced transition effects with over 100 combinations producing smooth transitions...
 
make flash screensavermake screensaverscreensaver maker
...your friends using high quality video and audio effect with a low bandwidth, no matter how far...audio encoder have great efficiency. This software captures images up to 30 frames per second from USB...with Windows Media Player or Real Player. Jpeg image snapshots can be made from video images. Detailed...
 
multicastrecordwebcamserveraudio encodeftpmultimedianetworkvideo chatmonitorvideo encodersurveillanceemailclientsmtpmp3compressh264 encodeh264 videompeg4communicationdecodedvrconferencebroadcast
Photo Toolkit

Freeware by VicMan Software
217 x 7177Kb downloads

Free Vista Files award
...one click. You can choose one of nine images resulted from the automatic correction or perform manual...and fine-tune the image, add artistic and lighting effects and more. Contains plugin for creating thumbnails of...
 
edit image freeresize imagesimprove imageretouch photojpeg artifactsedit photocaricaturebatch image editingcropautomatic red eye removalimage editorlighting effectphoto editorstraightenphoto suitcorrect color
Flash Photo Show

Demo by Epinoisis Software
12 x 10093Kb downloads

Free Vista Files award
...to a Screensaver. Features: - Imports all major Image formats JPG, BMP, PNG, GIF, Photoshop PSD, TIF,...Color. - Set Movie Size. - Auto Pan-Zoom images to fit area. - Add Navigation Buttons. -...
 
downloadsphoto showflash softwareeasy animationsflash slide showflash albumwebsites cooleffectsweb designanimated slideshowdigital picturesflash slideshowtemplates