1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Recover Keys Basic

Shareware by Recover Keys
36 x 5261Kb downloads

...* Microsoft Office * Adobe Photoshop * Adobe Illustrator * Corel Draw * Macromedia Dreamweaver * Macromedia...
 
recoverkeyretrieveproduct keywindowsadministrativeadmin toolsserialsoftwarelostofficesustemfinderbackupactivation keyrecover lost adobe keycd-keyreinstall
PaintStar

Freeware by Zhenzhou Wang
65 x 2640Kb downloads

...in a form of gif animation or image file sequence. Gradient Fill tools include linear,radial,square,conical(symmetric),conical(asymmetric) and shapeburst....display, and show grid supported. More then 30 File formats supported include JPEG, GIF, PNG, TIFF, TGA,...just like vector drawing programs such as Adobe Illustrator and Corel Draw. Multiple Undo and Redo supported....
 
freewaremorphlayerpathscreen captureimage editor
RasterVect

Shareware by RasterVect Software
36 x 23338Kb downloads

Free Vista Files award
...If you want to edit a raster file in your CAD program, you first have to...
 
dxfraster vector softwarerastervectrecognizevectorizercadscanconvert
MetaDataMiner Catalogue PRO

Shareware by Soft Experience
15 x 2549Kb downloads

...jpeg and tif images into XML, CSV, Word files or HTML pages without programming. Set file properties...Edition time - Standard or User-defined ie customized file properties, Mac comments, - Windows 2000 file propertes,...an HTML index of entire folders with extra file information and hypertext links : you can share...in HTML and XML exports. Option to include filename in the title fields property during folder mass...
 
batchcatalogminerconversionpropertiesfileproductivitymetadatalist directoriesexportutilityiptcarchivistgeneratorproject managementcmsxsladobehtmlofficerdfextractionxmladd-inscsvxmpdocumentationcontent
Equation Illustrator V

Shareware by MGCSoft
14 x 2131Kb downloads

...Equation Illustrator V has been designed to ease the difficult...be sent to the Windows clipboard as Enhanced Metafiles and bitmaps or saved to file for use...included, over 50 drawing tools in all. Equation Illustrator V is designed for people who know what...
 
periodicsciencegraphicsmathematical fontsmathschemistryequation illustratorchemicalvectorequation editor
Axialis IconWorkshop

Shareware by Axialis Software
26 x 37368Kb downloads

Free Vista Files award
...all your icon and library (ICL) files. A file explorer permits to browse disks and work with...files (images, icons, programs...). This explorer displays files in thumbnail preview mode. Use an exhaustive help...
 
icoicon makercreate iconvista iconmake iconicon editoricon managericnsiclmacintosh icon
Barcode Maker

Shareware by Lars Sams
59 x 16568Kb downloads

Free Vista Files award
...or as a vector barcode in the Enhanced MetaFile (EMF) or Encapsulated PostScript (EPS) both CMYK and...barcode using Free Text. Easy to use Help file included in setup. PDF manual and Video tutorials...
 
barcode generatorpngmetafilebmphigh resolutionbarcode makeruccemfgs1code interldpiupctifitf-14gtinbatchprice tagussprintingsequential barcodingcodabarisbnvectorlabel
...and send them directly to Adobe Photoshop, Adobe Illustrator and Corel Draw. ScreenDiscoverer gives an opportunity to...to clipboard as well as to an image file in different formats (.bmp, .gif, .jpg, .png, .tif)...
 
resizercolor pickingcolor swatchcolorsscreenshotcopy clipboardcolor samplecolor infohexsnapshotsampling colorcolor valueshtmlscreendiscovererhsvcolor characteristicscolor gammargbimagecolor formatscmykzoom
Sketsa SVG Editor

Shareware by KIYUT
23 x 16243Kb downloads

Free Vista Files award
...Sketsa is a cross platform vector drawing application based on SVG. Scalable Vector Graphics (SVG) is a graphics format and technology based on XML developed by W3C. With Sketsa, you...
 
drawingxmlgraphics editorsvgillustratorvector graphics
CeledyDraw 2

Shareware by Celedy Software Inc.
17 x 37270Kb downloads

...CeledyDraw 2 is a 2-in-1 Graphic Design and Desktop Publishing program that`s perfect for use in homes, schools, and small-businesses. CeledyDraw 2 is powerful, easy-to-...
 
drawing softwarepdf softwaredeskop publishing softwareflowchart softwarepage layout softwaregraphic design softwareeducational softwareillustration softwarebusinesscard software
WinTabs

Shareware by Primoz Gabrijelcic
10 x 279Kb downloads

...Cetus CWordPad, Cool3D, CorelDRAW, DejaVu, Delphi, Drag And File Gold, EmEditor, Eudora, Excel, Explorer, Fireworks, Flash, Forte...
 
toolsofficeeudorapowerpointphotoshopoperaexcelacrobatmozillawordtabnavigatorutilitiescoreldraw
Catalogue

Shareware by Soft Experience
13 x 3005Kb downloads

...Catalogue is a file metadata miner utility that enables quick viewing, management...of metadata or document properties associated with such files as: - Microsoft Office, StarOffice or OpenOffice.org documents...- Windows 2000 files - PDF documents - IPTC fields for JPEG...FrameMaker 7.0, GoLive 6.0, InDesign 2.0, InCopy 2.0, Illustrator 10.0, LiveMotion 2.0.
It is useful for...
 
xmpofficexsladd-insextractionutilitymetadatapropertiesproductivitydocumentationframeworkexportpropertygeneratorlist directorieshtmlfilerdfproject managementconversionxmldata minercatalogwindowspublication
Metadata Miner Catalogue PRO

Shareware by Soft Experience
23 x 2980Kb downloads

...jpeg and tif images into XML, CSV, Word files or HTML pages without programming. Set file properties...Edition time - Standard or User-defined ie customized file properties, Mac comments, - Windows 2000 file propertes,...
 
htmladobexmlproductivityconversioncatalogmetadataextractionfilepropertycmsutilitydocumentationbatchexportlist directoriesadd-insrdfcontentproject managementcsviptcgeneratorminerpropertiesxmpofficexsl
SPG ColorWorks WEB 4

Shareware by SPG, Inc.
21 x 1904Kb downloads

Free Vista Files award
...SPG ColorWorks 4 is an award-winning Web graphics plugin powersuite of 28 Web authoring tools for developers and Webmasters of all levels. Enhance your creativity with innovative and cutting-...
 
gif animationphotoshop pluginjavascriptweb developmentboitmap editingjpeg conversionweb designsite managementpaint shop proillustrator filegraphics optimizationrastor graphicstext animationweb graphics toolsimage map
...Do you have for a file can not browse and have been be embarrassed?Do...to your customer?If you have above demand, FIRST FILE VIEW will be you the best option. FIRST...VIEW is capable of displaying over 400 different file formats without the authoring application.Moreover, when you view...a file you do not need to specify the file...type. FIRST FILE VIEW automatically detects the type of file you...
 
fileview
SmartVizor variable data printing

Shareware by Uccsoft Inc.
23 x 13858Kb downloads

Free Vista Files award
...so that you can use a OLE Object file as your boilerplate document. So, you can use...Adobe InDesign or Adobe PageMaker or Adobe Illustrator or Microsoft Word or virtually any application to...
 
variablesoftwaredataprinting
...web and documents. Graphics Vector formats included Adobe Illustrator (.ai), Microsoft Design (.design) Xaml (.xaml), Adobe Flash...24x24, 32x32, 48x48, 64x64, 72x72, 96x96, 128x128 Total File Unit 42.408...
 
bmpflashxamlillustratordesignphotoshopvectoricon
...web and documents. Graphics Vector formats included Adobe Illustrator (.ai), Microsoft Design (.design) Xaml (.xaml), Adobe Flash...24x24, 32x32, 48x48, 64x64, 72x72, 96x96, 128x128 Total File Unit 7.638...
 
flashiconxamlphotoshopvectordesignillustratorbmp
...Fastest thumbnails viewer and full-function file manager with explorer-like interface. It allows you to...browse the thumbnails of files Adobe Illustrator v7-CS6 (AI, AIT, EPS), CorelDRAW v4-X6 (CDR, CMX,...that allows to display thumbnails for tens of file types in addition (DOC, PPT, PRN, PSP, MAX,...scaling, rotation and mirroring, displays full info about files (version, keywords, notes, fonts, linked files, etc.), can...
 
docinddflexisignphotopaintadobejpgdcxtifcoredrawcptbmpicopsdpcdpddclkxarindesignepsijp2htmlepicmxccxviewerfreehandcmvepsfprnmdiillustratorpngurlthumbnailbmfcdrwebemfpdf
Repligator

Demo by Ransen Software
22 x 17505Kb downloads

Free Vista Files award
...effects program for Windows. Simply import the image file and hit F7 a few times to see...
 
mosaiccameradrawingwoodeffectspop artvectordigicampostscriptivylichtensteinphoto flash effectwarholphotographdigital camerascannedoptical artgraphicsillustratorsepiaklee