1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Coin Collector

Freeware by Duck Software
25 x 955Kb downloads

Free Vista Files award
...can record whatever you want such as the history of the coin or a detailed description....
 
trackermintnumismaticorganizercatalogcollectormoneycoinhobby
...The Sleuthhound! Desktop Search brings search engine power to your PC and allows you...to instantly search files, documents, email, anything. The Sleuthhound! searches Microsoft...folders and directories and entire drives into your Search Zone. The Search Zone Manager allows you to...create several Search Zones and take control of what you indexed....
 
searchfiledesktopindexdocumentswindowstoolbarenginelostfind
...Orbits (orrery), location browser, Sky Quiz, and sophisticated searches embracing planets, comets, asteroids, DSOs, and up to...a Telescope", "Cosmology", "Dark Matter", "Eclipses", and "The History of Astronomy", to name but a few --...
 
sky simulatorskymapstarsorreryplanetsstarmapgalaxiesplanetariumencyclopediaatlascometsmultimediaasteroidsdsosastronomydictionary
...Website Investigation and Tracking software Monarch Search is powerful research software that allows the creation...of multiple searches based on a variety of criteria to monitor...Websites, pages and Keywords. You can create a search task to download documents, music, pictures or almost...any file. You may schedule a search for keywords or changes in a Website and...let Monarch Search know how you wish to be notified. Monarch...
 
miningmonitoringtrackinginvestigationsitemapwebsearch
Privacy Fence

Shareware by onlylsoft.com
12 x 738Kb downloads

Free Vista Files award
...mouse-click, it helps you to erase cookies, cache, history and auto-complete data of popular Internet browser. It...activities such as recycle bin, temporary folder, document history and clipboard. What`s more, it has more than...folder, recent document history, start menu run history, search history, clipboard and swap file. Erase tracks of...
 
privacy eraserinternet cleanerinternet track eraserinternet privacyinternet eraserprivacy softwareinternet history eraser
Photo Hunt in Hawaii

Shareware by Spinapse
12 x 24197Kb downloads

...You navigate the islands, exploring live-action scenes in search of your assignments. When you find one, snap...
 
game showboardgamespinneroutdoortravelculturecasualhawaiitraditiontriviafunhistoryentertainmenteducationalvacationbrainphotoseek and findmatchingtourvisitshootstrategy
DataTrack System 3.5

Commercial by Magnoware Systems
17 x 14890Kb downloads

...Find the information you’re looking for with comprehensive search functionality. -- Customize your software with user-defined fields....
 
issue trackingrequest trackinghelp desksupport managementtrouble ticketcustomer supporthelp desk softwarecustomer service solutiondefect trackingtask trackingcall centerhelpdeskservice deskwork order management
History Killer Pro

Shareware by Emergency Soft
7 x 2821Kb downloads

...compromising and dangerous files. At the same time History Killer Pro is a easy-to-use program with a...bin, unusable history, index.Dat file, cookies, cache, Internet history etc keeping your favorites website information untouched. With...custom search you can find all unuseful items related your...search query. See details at http://www.historykillerpro.co m/features.html History Killer Pro fully meets the U.S. Department of...
 
cachehistory killer protemperaseblockeronlinecookiesfilesinternet securitytrackssecurely deletetracesremoverecent listsprivacy keeperregistry cleaninternet privacylogsindexdat
cPWD

Shareware by Absolute Dynamics
14 x 725Kb downloads

...protect the local administrator account across the network. Search Active Directory. Target multiple Administrator accounts based on...Update services configured to logon with domain credentials. History kept on all system changes made with cPWD....
 
rename local admin accountchange local admin password
MyPrivacy

Shareware by Omniquad Ltd
12 x 7577Kb downloads

...Urls in your browser address bar, files you searched for, etc. Data that otherwise would be exposed...you visited, even the files or text you searched for … all these details are exposed for...to clear up the Windows Run, Find Files, Search Text, Media Player Recent File and URL list...
 
web erasercleanupnet eraserdeletionremoverecent documentssensitive datamedia playerurlsfreewarewipetemporary internet filedata erasersecuritytrack eraserindexdatinternet privacyhistory eraser
WINSWEEP

Shareware by Frank-Oliver Dzewas
19 x 2576Kb downloads

...the system or user change. Deletion of the history of the Internet Explorer. Deletes the last search...last opened with MS Office. Deletion of the search list in KaZaa. Cookies will be deleted completly...
 
ad-blockerdestroy surfing tracesanonymous emailsurf anonymouslyanti-viruspopup-blocker
Dutch Duck IE History Viewer

Shareware by Dutch Duck Software
40 x 11738Kb downloads

...Dutch Duck IE History Viewer is a History, Favorites, Cache, and Cookies...to erase your entire history. Dutch Duck IE History Viewer works with Internet Explorer 6 and higher...
 
favouritescacheprintinternet explorerfavoritescookiesdeletesearchhistory
Belkasoft BookaMark

Shareware by Belkasoft
10 x 3005Kb downloads

...and manage your bookmarks easily with Belkasoft BookaMark! Search them by different criteria, find duplicates, export and...
 
linkurltoolsbookmarkmanagersoftwareorganizesmartbelkasoftcomshareware
Complete Cleanup

Shareware by SoftDD Software
18 x 930Kb downloads

Free Vista Files award
...performance, and cleans up all cookies, cache files, history files, video cookies and local shared objects, ActiveX...controls and java applets, search engine data and auto forms data, previous passwords...and userid entries, index.dat files, MRU`s, and history URLs for all versions of IE, Mozilla Firefox,...
 
cleanerwebfiledeletewipeinternetcachedrivemozillacookieregistrycookiessoftwaresecuritywindowsexplorerdiskwasherremovecleanuphistorycookie cleanerprivacycookie cleanupremover
Free Vista Files award
...Byte-to-byte comparison , not by CRC.
* Search duplicate file contents regardless of file name
*...by size/ date/ version/ pattern/ folder
* Save search session
* Export result list (CSV format)
*...type of files, jpg, mp3, mpeg etc
* Search up to 100,000 files and more
* Preview...jpg, gif, bmp, wmf, tif, png etc
* Search over local PC and network
* Delete or...files better
* *

** Enterprise Ed.
 
dedupeduplicate mp3dupelessfile utilityfile managementclonemasternocloneduplicate filesduplicate image
Hetman

Shareware by SoftAge
11 x 15360Kb downloads

...Hetman is a dual-panel file manager with focus on details. Hetman has easy-to-use and convenient interface, each feature has been placed where you expect it to be...
 
word wraprevotext editorfile commandertabbed interfacesyntax highlightingukraineincremental searchjava file managermac osxftp-clientembedded consolebookmarkshetmanlinuxsoftagearchiverwindows network

Shareware by Somewhere Software
17 x 13795Kb downloads

...and played number combinations. Powerball Manager offers powerful search features that allow the used to search for...date and number In addition to the powerful search features this application provides, Powerball Manager also utilizes...historical drawing data to analyze the previous drawing history to calculate a probability factor for each number....
 
powerballgamblingpowerball lottery
FileWrangler

Shareware by CursorArts Company
27 x 2893Kb downloads

Free Vista Files award
...upload or download files to internet sites; - History list of recently accessed folders (so you can...
 
managerprintunziphidewipesearchsynchronizeeditlistingssplitterspanlistsfilespatchingmanagementftpcabcompressionarchiveexplorerencryptsplittingviewerfindcopypatcher
CleanDisk

Freeware by FMJ-Software
13 x 346Kb downloads

...files - Internet Explorer cookies - Internet Explorer history - Mozilla Firefox cache - Google Chrome cache...
 
cleanuninstallsearchremovecleanerjunkfiledisk
...images viewed. As an added convenience, it can search the computer and locate all of the cache...hide their activity, people often delete their browser`s history list -- but they will forget (or do...
 
listcrimepagespyviewparentalcookiesspousewifehusbanddeletekidschristiansearchfileinternetcontrolswebfilesexploreinvestigatechildrenbrowsertitlesoftwarehistorycomputercacheforensic