1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Advanced HTML Protector

Shareware by Creabit Ltd.
18 x 1741Kb downloads

...all too common. This applies not only to HTML or Javascript code, but also to everything else...need a professional and effective solution - Advanced HTML Protector will help you to prevent people making...unauthorized copies of your Web Page. Advanced HTML Protector protects your Web Page, including HTML code,...Page using six encryption schemes and makes the source code impossible for people to read or steal....
 
businessprotectdownloadssourcesoftwarehtmlwebsitecreabithidewebdesignpageencryptdevelopment
HTML Text Extractor

Shareware by Iconico
30 x 469Kb downloads

Free Vista Files award
...text or if you need to view some HTML that`s been encrypted then this application is a...must. HTML Text Extractor is the simplest and easiest way...to view and save the HTML and Text from any webpage. - Easily extract...HTML code and Text from any webpage - Extract HTML...pages that have been protected or encrypted with HTML locking programs - Simple to use - Extraction...
 
extractortextasciicodehtmlencryptedcsssourcewebtoolclickunselectablejavascriptwebsite
AeroTags TagsLock Pro

Shareware by AeroTags Software
18 x 1045Kb downloads

...own a website and need to protect your HTML files with password, encrypt the content of your...web pages and hide source code of your HTML and XML documents? There is a solution! Today...your web site content with password, and encrypt HTML files. TagsLock Pro offers the easiest way to...organize HTML password protection for website content. It can also...JavaScript or VBScript.
 
protectenhancewebdesignwebsiteblockantispamemailcontentextractors
Atrise HTMLock

Freeware by Atrise Software
24 x 537Kb downloads

Free Vista Files award
...HTMLock allows you to create password protected HTML pages and hide HTML source of your pages....With this tool you can encrypt HTML pages and place them on your web site,...DVD, or hard drive. You can password protect HTML and text files. The program is based on...anywhere. The user-friendly wizard helps you to encrypt HTML and text files in just a few clicks....
 
protectpasswordhidesourcehtmlwebprotection
...Right HTML Protector prevents others to use your articles, artwork...that are very common for this day. Encrypted HTML and source code also blocks web site rippers...could get hundreds of spamming letters daily. Right HTML Protector features six encryption methods that allows include...and drag & drop. Users don`t need any HTML and programming knowledge. It is very easy to...
 
protect xmlhtml protectorprotect websitehide source codeprotect source codeencrypt htmlhtml encryption softwareprotect html
AdrianSoft Webmaster Tools

Shareware by AdrianSoft Inc.
18 x 2238Kb downloads

...Software to Convert html into php,asp,cgi,perl,jsp,javascript,vbscript,text, compress and encrypt html source code,...protect html source code, create php-nuke modules,block, create popup, create meta-tag...generate noright click script, encrypt & hide url link,email...
 
html javascripthtml vbscripthtml cgihtml phphtml convertermaskeroptimize htmlcreate php nuke blockhtml jspconvert htmlcreate popupgenerate popupcompress htmlhtml encryptorencrypt htmlhtml aspgenerate meta tag
Atrise Stealth

Shareware by Atrise Software
9 x 471Kb downloads

...The program is an ultimate HTML source hide, images, forms and antispam protection software from...methods. The second generation protection technology from the HTMLock developer. The program is based on the second...can also find in the Internet dozens of HTMLock software clones from another software developers. Now you...
 
htmlhidespampsychologicalcodeimagesourceencryptionlockprotectionantispam
CAD KAS PDF Editor

Demo by CAD-KAS GbR
35 x 7221Kb downloads

...the pages or delete pages. Also you can hide the information on a page so that it...Add stamps like "Confidential" or "Top secret". The source code of the page (a language like HTML)...
 
acrobatcad-kasinformationfilescreate pdffilesportable document formatdeletepdf fileshidepdf documentspdf editor
PDF Editor Objects

Demo by CAD-KAS GbR
32 x 7221Kb downloads

...Add stamps like "Confidential" or "Top secret". The source code of the page (a language like HTML)...
 
pdf filesdocumenteditacrobatportable document formatinformationcreate pdffilescad-kaspdf editorhidedeletepdf documents
...Encrypt HTML source is a solution for full web site protection....encrypt your HTML, ASP, JavaScript, VBScript,SHTML and CSS source code and will make impossible stealing and reusing...encrypted files. Add referrer check (domain lock), encrypt HTML formatted emails, and compress html code. Hide HTML...source from email spiders and site rippers.
 
websiteencrypthideimagevbscriptsourceshtmlaspscramblepasswordlinkjavascriptprotectcode
...HTML password protection, encrypt HTML files with 448 bit keys. Hide html source...
 
vbscriptaspencryptjavascriptwebpagelinkwebsiteimageshtmlprotectpasswordscramble
...123 HTML Protector is a software to protect your web...others from viewing and reusing your web page source code, including HTML source code, JavaScript, VBScript, text,...
 
protect htmlprotect web pagehtml protectweb page protectencrypt javascripthtml encrypthide html source codeweb site protectencrypt html sourceprotect html sourceweb page encryptionprotect image
HTML Guardian

Demo by Protware
48 x 8948Kb downloads

...HTML, SHTML, JavaScript, VBScript, PHP and ASP files. Hide HTML source code from web site thieves. HTML Guardian is a...-it will make impossible stealing and re-using your source code in other websites.. Image protection add-on [Image...referrer check to them. You can also encrypt HTML formatted email, and compress html code. HTML Guardian...rippers and web content filters.
 
htmlpasswordphplinkcodeencryptwebsitejavascriptsourceimagevbscripthideshtmlaspprotection
WebWrap

Shareware by Tac-Software
29 x 727Kb downloads

...is a small utility program to compress and code your HTML web files. It uses either a...by more than 50%. It also renders the source of any HTML pages you have created, your...software. In addition to compressing and coding your HTML files, you also have the opportunity to add...
 
html compressionhide html codezip internet documentshtml zippassword protectionencryptioninternet utilitywebsite coding
JRStegano Activex

Shareware by JR Software
19 x 691Kb downloads

...Activex Control for Steganographie. JRSteganoActivex allow you to hide (and extract) any data file inside a perfectly...of using JRSteganoActivex DemoVB6 Visual Basic Demoprojekt with Source Code To test: Dont forget to register the...
 
datahidedecryptedpngtextstringsbasicfilescontrolsteganographieimagesecurepicturesecurityactivexbmpstegoextractedpassword
Download Multiple HTML Source Codes Software

Shareware by Sobolsoft
15 x 758Kb downloads

...Download one or more HTML source files from a web site to folder(s). Load...
 
htmsave pagesource code pagessitesdisplayhidelinksviewingshowingpureinternetexampleshttpsautomaticretrievingeditordownloadingsave file