1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Bud

Shareware by BudTools Software
5 x 24641Kb downloads

...Bud is an organizer - a revolutionary Windows Add-on which puts you in complete control of...and links in folders on the BudBar, then group it for fast and easy access. You can...
 
templatesexpresstaskseventsorganizermergecalendarspasswordsoutlookzipreminders
Hide My Folders ActiveX

Shareware by ELTIMA Software GmbH
13 x 1354Kb downloads

...is a robust ActiveX Control that lets developers hide any file or folder in Windows system. You...file/folder names you could define pattern-matching mask to hide a group of files that complies with certain...such as same extensions or similar names. Using Hide My Folders ActiveX methods and properties you could...flexible set of various methods and hiding properties. Hide My Folders ActiveX supports NTFS, FAT32, FAT file...
 
hide folders activexsecure files and foldershide files activex
..."Read Only", "Full Control". It works with any Windows platforms : 2000/XP/Seven . Dark Files can work...folders (including subdirectories) in various ways. You can hide them or prevent others from deleting, renaming, executing,...
 
windowsprotectionpasswordfoldersfilescontrolsecurity
...replacement which is five times smaller than the Windows version. User friendly interface lets you change volume...levels, group playback and recording controls in any of five...It can read track information used by the Windows CD Player, and uses the same hot-keys as...
 
shortcutssoundwindowscontrolmixersndvol32softwaretweakrecordingvolume
ID_Bank

Shareware by Rainbow Innovations
14 x 2206Kb downloads

...using the Rijndael 128 bit encryption algorithm. · Group your data into categories. · Fully customisable display...using Copy/Paste or Drag and Drop. · Auto hide and password protect ID_Bank when Idle. · Clipboard...· And many other features. System Requirements · Windows 98/ME/NT4/2000/XP/2003/Vista/2 008/Windows 7/Windows 8...
 
passwordusenameuser namerijndael encryptionsecurityidbankpassword managerpassword protection
Magic Notes

Shareware by Eskil Software
12 x 3581Kb downloads

Free Vista Files award
...new features in V4.1 are; - Fully Vista, Windows 7 and Windows 8 compliant. - Comes in...text the way you want it. - Better group functionality with quick access to see all notes...in the same group and quick keys to change groups, by using...window title. The note will then show and hide as the other window does the same. -...
 
stickysharewareutilitywindowswindows7printpimalarmwindows8postitprogramremindnote
FileWrangler

Shareware by CursorArts Company
27 x 2893Kb downloads

Free Vista Files award
...(including disk spanning and self-extracting, read and write Windows CAB files, or create encrypted LOK format archives....documents without extracting, etc.); - Security options to hide file types, folders and drives from file manager...which allows you to break large files or groups of files to fit onto multiple disks (may...jump back); - Scheduler; - Folder synchronization; - Group Rename; - Change file creation and file modified...
 
managerprintunziphidewipesearchsynchronizeeditlistingssplitterspanlistsfilespatchingmanagementftpcabcompressionarchiveexplorerencryptsplittingviewerfindcopypatcher
WinHide

Shareware by ZCS
19 x 993Kb downloads

...WinHide is a program that quickly hide your working programs and windows. You don`t need...to close your working applications, just hide it. The hidden programs are not displayed in...but programs continue to be executed. You can hide and restore programs using keyboard shortcuts, WinHide System...Tray menu or the WinHide window. Imagine that you have a lot of...Internet Explorer windows open at the same time, and for one...
 
window hiderhide applicationapplication hiderwin hidewinhidehide window
All In One Computer Tools

Shareware by Tools4PC
12 x 2335Kb downloads

...when you login, like spywares or adwares which windows starts when you login. Protects your privacy by...computer at schedule time you specify. Registry Enhancement:Change Windows default settings, without you need to edit the...registry. Setting group of window you can Hide/Block/Topmost with Hotkeys pressing....also be very useful when you want to hide several windows very quickly, like when your boss...
 
managementinternet passprivacyspywareoutlook passwordsstartup managerwipeshredrecover web passwordenhancementhotkeyshide group windowstopmost group windowsauto shutdowntweaksblock group windowsadwaretracksvirtual desktopencrypt
FSL Launcher

Freeware by F.S.L. - FreeSoftLand
32 x 3229Kb downloads

Free Vista Files award
...- Multi-Users management: separated shortcuts database for each Windows user. - Drag & Drop support (copy or...move from-to desktop or Windows folders) - Auto-hide function with customizable show and...shortcuts trough categories. - Moving around in a group by letter keys. - Button mode; compact icons...size, date and other hints). - Auto select group when mouse move over group tab option. -...Large Icons. - Multi-desktop and dual-monitor support.
 
iconsshortcutslauncherorganizerfilestool
Aml Pages

Shareware by G&G Software
15 x 4587Kb downloads

...tree - most comfortable way to store and group such type of information. You could mark each...it`s part. You can set adjustable filter to hide unnecessary parts and highlight only important data. You...
 
web page savingorganizersticky notescontent saveraml pagestext capturenote-takingweb grabberpassword protectiontree-likeweb miningprocessorweb saveroutlinerchm
Control Runner

Shareware by MomSoft
23 x 2581Kb downloads

Free Vista Files award
...Runner is a program launcher and manager for Windows (95/98/Me/2000/XP) that can substantially increase your productivity. Control...There are two ways of launching programs on Windows systems: clicking on a shortcut placed on your...powerful and convenient tabbed interface, allowing you to group together related items, whether they are applications, documents...applications running in the background? Control Runner will hide them for you. Do you want to prevent...
 
managerdesktopprogramutilitymonitorlaunchershell

Shareware by SSS Lab., Inc.
15 x 1080Kb downloads

...`Read Only`, `Full Control`. It works with any Windows platforms : 9.x/ME/NT/2000/XP . 1st Files Privacy Tool...folders (including subdirectories) in various ways. You can hide them or prevent others from deleting, renaming, executing,...
 
passwordwindowscontrolsecurityprotectionfilesfolders
Icon Genesis

Shareware by Gamers Tower Inc
24 x 3278Kb downloads

...revolutionary and powerful desktop icon management tool for Windows XP that can increase productivity, save time and...boost fun by using Icon Groups and "Live!" Interactive & animated 3D icons. Icon...beautiful 3D animations. Icon Genesis seamlessly integrates into Windows XP and features easy to use GUI Interface;...with 39 3D animations for 13 mostly used Windows icons. Users can use custom GIF animations in...
 
interactive iconsanimated iconslive iconsicon genesisgamers tower inc
..."Read Only", "Full Control". It works with any Windows platforms : 9.x/ME/NT/2000/XP . Protect Files Pro can...folders (including subdirectories) in various ways. You can hide them or prevent others from deleting, renaming, executing,...
 
passwordwindowsprotectioncontrolfilesfolderssecurity
Desktop Assistant

Shareware by KutinSoft.com
4 x 1630Kb downloads

Free Vista Files award
...running processes in the RAM. It allows to hide visible window or to take away a program...transpose elements in the Start menu. You can group them by yourself or with the aid of...
 
processfaststarttoolsrebootmenushuthotcomfortable
ShareAlarmPro

Shareware by Nsasoft US LLC
1 x 2945Kb downloads

...Log Monitor monitors the security event logs of Windows NT/2000/XP servers or workstations and notifies the user...your workstation, disable or enable default administrative shares, hide your workstation on the network, view the number...“Everyone”, “Domain Users” or other selected broad access group is added to the permissions of a share....
 
shared foldersaccess monitoringalertaccess detectnetwork accessnetwork sharesnetwork sharingnetwork securityfolder monitoringnetwork protectionfile sharesecurity eventsnetwork monitoringevent logintrusion detection
Trillian Astra

Free to try by Cerulean Studios
28 x 14500Kb downloads

...better in Trillian Astra] Reduce desktop clutter by grouping message windows together with a simple drag and...at the top of the message window. Astra windows can also display the widgets from a user`s...drag and drop images directly into Astra message windows to instantly send photos to your friends. Click...time. Back to top Chat with a Big Group Chat Room Browser [New in Trillian Astra] Browse...
 
file transferskypeastraastra profileircxmppgoogle talkfacebookaimwindows live messengerjabberchat windowsicqmyspaceimyahoo messengertwitter
Multi Desk Assist

Shareware by Sondle
4 x 1397Kb downloads

...Multi Desk Assist is a comprehensive windows virtual desktop software to create multiple desktop and...virtual desktop on major windows operating system. It is an easy to use...virtual desktop tools.You can create multiple windows desktops on one computer. You can switch among...number key. You can run each application, or group of applications on a separate virtual desktop.Never minimize...of them.
 
virtual desktophide softwareboss keyhide desktopmultiple desktop
Odin Screen Capture

Shareware by Odin Share Company
3 x 1913Kb downloads

...user-defined area.It can help you quickly print a group of screens and save the images in PNG,...that it includes global hotkeys,you can dispay or hide printscreen window.It would not effect you to do...is very easy to use.Features:1.Hotkey for show or hide printscreen window.2.Hotkey for capture desktop top window.3.Hotkey for...full desktop.5.Pop up save-print window after capture.6.Display the windows when everytime runs.7.Save images in kinds of formats...
 
screen capturescreen printprint screenscreenshot