1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
PicaJet Photo Organizer

Freeware by PicaJet.com
161 x 5064Kb downloads

Free Vista Files award
...(Camera, Camera Vendor, Camera Model). You can assign icons to each photo for organizing your collection. Use...Picajet`s standard icon set or generate the icon from the imported image itself. Quickly find any...cues. PicaJet`s powerful search function makes locating a group of photos or a single shot relatively easy....You can locate photos by: * Without Groups * Date, Rating * Imported Date * Location...
 
photo organizerphoto organizingphoto gallery softwarephoto management softwarephoto album softwarecataloging tool
Imagicon

Freeware by Devious Codeworks
112 x 1499Kb downloads

Free Vista Files award
...(24-bit): Windows or OS/2 Bitmap (BMP), Independent JPEG Group (JPG), Portable Network Graphics (PNG) and Windows Icon...alpha transparency of icons. The interface window of Imagicon can be personalized with custom designs. The user...can select to save icons with the following dimensions in pixels: 16 x...48, 64 x 64 and 128 x 128. Imagicon also features the ability to drag `n` drop...
 
freepngformatimagiconbatchcodeworksbmpjpgdeviousimagewindowsconvert
FontLoader

Freeware by Moon Software
57 x 514Kb downloads

...both novice and professional computer users. 2) Font group loader in system tray. You can build your...own font groups to load on demand, just by clicking on...the program icon in the system tray area near the clock....The group loader module is small (only around 70 KB)...
 
fontloaderextensioninstall fontfont loadershellfont installeruninstalltryetype
PicaJet FX

Shareware by PicaJet.com
31 x 6180Kb downloads

...(Camera, Camera Vendor, Camera Model). You can assign icons to each photo for organizing your collection. Use...Picajet`s standard icon set or generate the icon from the imported image itself. Quickly find any...cues. PicaJet`s powerful search function makes locating a group of photos or a single shot relatively easy....You can locate photos by: * Without Groups * Date, Rating * Imported Date * Location...
 
cataloging toolphoto album softwarephoto organizingphoto organizerphoto management softwarephoto gallery software
Quick Access Folders & Files

Shareware by TallSoft
47 x 1935Kb downloads

...folder/file could be placed in more than one group ,while Quick Access Folders & Files provide multiple...by clicking the "Quick Access Folders & Files" icon in system tray (popup favorites menu) (3) access...the object is "group", all items in the group will be opened or executed Quick Access Folders...
 
quick accessdesktop enhancement toolsaccess folderswindows file dialog utility
IconChanger

Shareware by Shell Labs
52 x 1142Kb downloads

Free Vista Files award
...Does your desktop look plain and boring? Get Icon Changer! Icon Changer is a software application that...makes changing icons fun and easy. It`s a hassle-free way to...open up any computer manuals. Simply click the icon you want to change, point at the one...you like and that`s all. Change icons to make navigation easier, to group similar applications...created with these (and other) applications "inherit" the icon from the program from which...
 
change iconassign iconicon tooliconscustomize iconcustom iconicon searchicon explorercursorsicon browser
Accessor.Launchbar

Shareware by Accessor Software
25 x 1268Kb downloads

...search for the necessary file. Just add an icon for a program, a document file or an...for opening programs and files, but also to group them into separate panels depending on their purpose...
 
toolbarlaunchbardesktopaccessorquicklaunch
Roll Call

Shareware by Westbrook Software
57 x 2228Kb downloads

...menu that is presented when Roll Call`s tray icon is right clicked. For instance, you can define...sequence to change your status. Roll Call`s tray icon also graphically represents what your status is. When...with each employee record is a notes section, group list, email address and a phone list. Groups...
 
employeecorporatemessagingawarenesspegboardpresenceofficeinstantfindsoftwarelocateworkernetworkelectronic
ID_Bank

Shareware by Rainbow Innovations
27 x 2206Kb downloads

...using the Rijndael 128 bit encryption algorithm. · Group your data into categories. · Fully customisable display...
 
passwordusenameuser namerijndael encryptionsecurityidbankpassword managerpassword protection
MacNames Site License

Commercial by Soft Experience
25 x 2589Kb downloads

Free Vista Files award
...Services for Macintosh (MacFile), Cyan Software MacServerIP or Group Logic ExtremeZ-IP. It is probably the only Windows...
 
sharewarecross platform namingextensionautomationconvertorsserversmacnamessoftexperiencerenamerrepair utilitieswindowsfile maintenancedata forkrenamingfile signaturesmacintoshicon
FileWrangler

Shareware by CursorArts Company
35 x 2893Kb downloads

Free Vista Files award
...which allows you to break large files or groups of files to fit onto multiple disks (may...jump back); - Scheduler; - Folder synchronization; - Group Rename; - Change file creation and file modified...modes to suit yourself: list view, tree view, icon view, and with or without displaying file attributes...
 
managerprintunziphidewipesearchsynchronizeeditlistingssplitterspanlistsfilespatchingmanagementftpcabcompressionarchiveexplorerencryptsplittingviewerfindcopypatcher
Free Vista Files award
...attached a note. It`s easy to control the icon that you associate with each email, and to...administrative managers can set up meetings and coordinate group activities quickly and easily, accumulating important information and...
 
attachcontactsemailsticky noteoutlook
WinHide

Shareware by ZCS
54 x 993Kb downloads

...Hide/Show active window Hide/Show all windows Hide/Show a group of windows. You can specify groups of windows...and set hotkeys for them. (For example, a group can comprise all windows that have `Internet Explorer`...it is there or optionally can put an icon in the system tray for a quick access....
 
window hiderhide applicationapplication hiderwin hidewinhidehide window
MultiStart

Shareware by Michael Brick
15 x 441Kb downloads

...for Windows 95/98. The program fits to the trayicon bar and serves to summarize to groups and...to start simultaneously various applications. Arbitrarily many program groups can be created and arbitrarily many files may...software builds a popup menu of all created groups and with that a simple mouse click suffices...
 
tray iconapplicationswindowsshell extensionprogram groupsautostart
4t Calendar Reminder MP3

Shareware by 4t Niagara Software
22 x 1173Kb downloads

...any complex reminder before event and determine actions group for it. - Rich event options. For each...tell you a persons age). - System tray icon and hint window with upcoming events. - Preview...
 
wavmp3schedulereminderplannere-mailschedulercalendarorganizetemplateeventalarmwinamporganizer
AT File Mole

Shareware by Alex and Alex Soft
31 x 784Kb downloads

...or remove some chunks and separately images of icons or cursors, save both a user selected image...and the group of image in ICO, CUR, BMP, JPG, GIF,...
 
aniextractgrabjifbitmapocxchunkframeeditorresourceswavriffcursoreditingdllexeiconcpl
SuperZip - Zip/Unzip Utility

Shareware by Integratech Software
45 x 1000Kb downloads

...Explorer, an archive browser and viewer, automatic program group and icon creation for extracted files, multiple floppy...
 
pkzipcompression utilitypkunzipwinzip
FSL Launcher

Freeware by F.S.L. - FreeSoftLand
42 x 3229Kb downloads

Free Vista Files award
...Tired for dozen of icons on your desktop? Try this simple but powerful...shortcuts trough categories. - Moving around in a group by letter keys. - Button mode; compact icons...options. - Single click launch option. - Program icon options: Show On Taskbar, Show in the System...Tray and Don`t Show. - Customizable tray icon color (default blue, red, white and black) -...size, date and other hints).
 
iconsshortcutslauncherorganizerfilestool
UltraButton

Shareware by AntsSoft
16 x 2602Kb downloads

...attributes such as font style, button background and icon image. If you are an experienced Web designer,...can also use UltraButton to quickly make a group of Web buttons with consistent appearance for your...
 
gif buttonjpeg buttonbutton makerflash buttonweb button
Ssetup

Freeware by Davor Zorc
30 x 287Kb downloads

...directories and copy files to them, create Program group and start target application. Very easy to use....multiple source media -option to put main application icon on Windows desktop -insert your own picture logo,...
 
setupinstall