1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
MailEnable Standard

Freeware by MailEnable Pty. Ltd.
67 x 34838Kb downloads

...providing SMTP (Simple Mail Transfer Protocol) for transmitting email messages between servers on the Internet. Some of...you can run scripts or executables on an email SMTP authentication, allow/deny email where the sender domain...postoffice or globally, configure catchall, abuse and admin emails easily, configure redirection for email addresses, import Windows...users, import group members from CSV files, customisable user export, W3C...
 
popmailenablemail enablemail serverhttpmailpop3email servere-mailsmtpweb mail
AutoMSW

Freeware by Beiley Software
48 x 554Kb downloads

...is an easy to use, yet powerful bulk email client. Use AutoMSW to send individual, personalized emails...messages quickly with parallel threads. You can send email using the built in SMTP server, your own...ISP`s SMTP server, or your MAPI email client (such as Outlook Express). It includes mail...a "Verify" mode so you can validate your email addresses without actually sending a message. Global and...run AutoMSW unattended from a batch file.
 
mass emailnewsletter email softwarebulk emaildirect mailemail senderemail marketing softwarebulk email softwaremailing softwaregroup mailere-mailgroup emailernewsletter mailergroup email client
...Mail Sender Express Pro is a professional high-speed e-mail sender...program that allows you to organize large email marketing mailing lists in groups for easy manageability...to make your email marketing campaigns simpler. Here are some features of...this mass emailing utility: - Easy email list management: Maintain mailing lists by defining mailing...
 
mass emailingbulk email softwarehtml email marketingemail sendingmass email marketingemail marketing softwarebulk emailing softwarebulk email advertising
...Contentsmartz Mail Sender Express Pro is a powerful targeted e-mail sender...software. It is a business-mail sender program that allows you to organize your huge...mailing lists in groups and uses email content filters to make mass mailings simpler. Email...Pro manages your mass mailing lists by defining groups of targeted customers. One can easily add, delete,...copy-paste, and modify recipients of different emailing groups.
 
email server softwarebulk email servermass email senderemail content filterbulk email senderemail campaigns
CyPics - Photo Cataloging

Shareware by CyWarp
18 x 18904Kb downloads

...can be saved to create a permanent image group for slideshows and printing. Future photos of people...together with formatted text. Photo sharing options include emailing photos and slideshow export to HDTV, iPad, iPhone,...Apple TV & Photo Frames. The email module allows you to manage the size (kb)...of the email and add captions and the sender details to the photo. A common text selector...
 
pictureexifslideshowsoftwareiptccataloguingalbummanagementdatabasecypics photo catalogingdvdimagedigitalcameraphotographorganizerphotographyelectronicasset
...FXstyle Bulk Email Direct Sender is a professional high speed bulk email direct...sender program. This program is a powerful group mailer which sends your message directly from your...been read. As a multi-threaded application, FXstyle Bulk Email Direct Sender`s normal sending speed can reach 80,000...
 
email marketingbulk emailsubscriptionsemail sendercan spamprospectscampaignsemail bulk softwarecommunicateopt-inmass email

Shareware by ExecuteIT
7 x 2870Kb downloads

...Manage subscription or unsubscription by email subject. GoMail Subscription Manager works seemlessly within Microsoft...particular subject line and automatically save/remove the sender`s email address to/from a specified Outlook Distribution List....
 
unsubscribeemail marketingoutlook distribution listinternet emailsubscription managermailing listopt-ingroup mailoutlook crmgomailmass mailcontacts manager
Advanced Mass Sender

Demo by KBB Software, LLC
703 x 3821Kb downloads

...AMS 4.3 is powerfull email marketing software, developed to manage and send mass...quantities of emails to a great number of clients. Fast speed,...interface, and affordable cost make AMS the best email marketing program today. Build-in Smtp server, powerful, supporting...packet-sending emails without using the smtp server of your provider...allows you do send up to 500 emails a minute using a modem. The unique ability...
 
internet businessbulk email softwarebulk marketingmass email softwareemail marketingdnsproxymass mailemails marketing softwareamsfree downloadadvanced mass sendersmtpbulk email sendermarketing bulk mailermail list validator
...Buy! 3 Day Full Version Trials of Edge Group Mail. Group email and imported lists. Set up...unlimited groups in your address book. Enter unlimited contact information...from text file or clipboard. Search Filters Import Emails Comprehensive Merge Tool will merge your address book...unlimited Accounts and Address Groups. Set up multiple sender profiles. Add, update or delete profiles. Bypass server...
 
email marketingnewsletter managementgroup mailemail advertisingemail newslettergroup email senderemail managementbulk maileremail verifiermass mailerbulk mail sendermass email software
...manage and send SMS text messages instantly to groups or individuals via your Internet connected computer. Bulk...
 
massive smsbulk smssms promotioncontactsmarketingsms senderaddress booksms advertisingunlimitedsms mailersend smsnewslettertext messagecellularmass mailinglistsms softwaremanage smspersonalizedsms group
...Free email marketing software - Send personalized emails to thousands of people and automatically manage email...use product is your ideal communication tool for group email, email marketing, customer communication, event notification, newsletter...built in SMTP server and also support external email server. It has unlimited email list size. It...can import existing email list, copy paste email list.
 
mass email toolemail list managementnewsletterpersonalized emailinternet marketingemail mailing listgroup email senderbulk emailemail marketingemail notificationfree email marketing software
MobiSMS for Outlook

Demo by MobiMarketing
29 x 584Kb downloads

...our unique SMS dictionary and add your own Sender ID to outgoing messages. Use our SMS Control...Panel to set individual and group use, perform adds, moves and changes and retain...
 
microsoft outlooke-mailglobal smsmobilityoutlook expressmobile phonecell phoneemailoutlook pluginfree sms
free best bulk email software

Freeware by Bulk Email Software
10 x 7660Kb downloads

...The best bulk email marketing software,which is "Best Bulk Email Software",the product...is a mail group sender software, and produced by one group of elites,who...work at professional Mail server development and Anti-trash Email rules.Meanwhile,which functions contain e-marketing and E-mail state following.The...same kind of product. 3.No limited of the senders and following service.
 
best bulk email softwareemail senderbulk email marketingemail marketing softwarebest bulk emailer
eMarkSofts Email Extractor

Demo by eMarkSofts
14 x 1503Kb downloads

Free Vista Files award
...eMarkSofts Email Extractor can extract up to 100,000 targeted email...addresses per hour. It extracts email addresses from NNTP Servers. eMarkSofts Email Extractor works...than the search engine extraction programs that harvest email addresses from search engines. They have to use...an entire web page to extract just few email addresses. With eMarkSofts Email Extractor you are only...thread and it works many times faster.
 
email extractor liteemail searcheremail address extractoremail spideremail marketingemail hunteremail collectoremail finderemail harvesteremail sender
...need to pre-register. Manage your groups, create personalized email messages and safely send them to your recipients....your recipients from Excel No monthly fees, unlike email services Remote access from any web browser Campaigns...- handles bounces and unsubscribe requests Send personalized email messages No need to pre-register * Easy Deployment,...and announcements. * Excel import and export your groups of recipients.
 
bulk maileremail marketing programbulk email softwarefree newsletter softwareemail blastemail senderfree emailing softwaresend bulkmailing lists software
inwise Desktop Pro newsletter software

Commercial by inwise
4 x 7837Kb downloads

Free Vista Files award
...need to pre-register. Manage your groups, create personalized email messages and safely send them to your recipients....your recipients from Excel No monthly fees, unlike email services Remote access from any web browser Campaigns...- handles bounces and unsubscribe requests Send personalized email messages No need to pre-register * Easy Deployment,...and announcements. * Excel import and export your groups of recipients.
 
bulk mailerpersonalized emailbulk email softwareemailing softwareemail sendermailing lists softwaresend bulkemail marketing programfree newsletter softwareemail blast
...Group Email Sender is designed for e-mail marketing campaigns. this Group...Email Sender offers a complete solution for HTML-based email advertising. It is an easy-to-use, powerful and cost-effective...tool for Internet business professionals. Being a bulk group mailer, Our Group Email Sender helps marketers increase...
 
groupemailsender
TextMagic Messenger

Commercial by TextMagic
9 x 3020Kb downloads

...book to store all your mobile phone numbers. Group sending of the same message to multiple phone...the mobile phone. Show your own mobile as sender or Company name as Sender ID. They can...Their replies are forwarded for free to your email address or TextMagic Messenger inbox....
 
phonescomputer mobile textcomputer texttexting programonline text messagingonline smstext frommobilessms from computertextmagsms softwaremessagesbulk text messagingsend
G-Lock EasyMail

Shareware by G-Lock Software
5 x 20173Kb downloads

...G-Lock EasyMail is a professional bulk email sender software for targeted email lists building and bulk...or in a remote database. Using this bulk email program you can import your mailing list into...G-Lock EasyMail is integrated with G-Lock Analytics - email tracking service - that helps you clearly understand...what is happening to your emails after they are sent. Email tracking metrics such...
 
listsbulksoftwareeasymailemailcheckmarketingg-locknewslettersmailingmanage
Mass Email Sender

Shareware by Mass Email Sender
6 x 2383Kb downloads

...As the advanced bulk email sender in today`s market, Mass Email Sender can handle...tasks of creating, sending, reporting and analyzing marketing emails without taking you too much time and energy....of business promotion. That connection with customers via emails is one of the most essential ways to...boom your business and gain advantage. Hence, Mass Email Sender, designed for the use of sending group...
 
bulk emailemail marketingemail marketing deliverersmtp softwaremass emailerbulk emailersbulk emailingmass email senderemailing softwarebulk email senderlegalemail sender software