1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 ... 20 21 22 23 24 25 26 27 28 29

Sort by : ReleasedNameDownloadsAddedRatingRelevance
eMule File Swap

Freeware by eMule File Swap Ltd
24 x 2203Kb downloads

...as different types of search using local and global servers, web based search over Jigle and Filedonkey...
 
file searchp2p networkpeer-2-peerkadpeer-to-peerfast searchfast downloadmp3emuleedonkey2000ed2kfile sharing
...competitive cost, almost becoming the same choice of global medium and small business customers....
 
managementnetworksoftware
EzDNS

Demo by ezdns.com
10 x 2266Kb downloads

Free Vista Files award
...and/or e-mails your PC`s local LAN IP and global WAN IP address, currently running processes and connection...
 
popproxyhostezdnsprocesscabletcpsharewareprotocolpageaddresshttpofflinefrantzensofturlinternetdsllandeveloperportmonitoronlinepublishlocal infopostersocketdomainfirewall
Classic Scroll Bar AS 2.0

Shareware by Flashtuning
3 x 1Kb downloads

...overlay customization support * Per instance skinning. Only global skinning is allowed. * Custom scroll easing support...
 
flash componentsscrollbaractionscript

Shareware by Edelwise Inc
18 x 9079Kb downloads

...VB6 and C programs as if they where global variables of a single program. With beWISE you...
 
ipcmulti-taskinginter-processdistributedsoftware agent
Risky Wars for PC

Shareware by Christian Gross
3 x 8964Kb downloads

...Risky Wars is a highly challenging world domination game experience of strategy, risk and conquest. Players control army units on a map where each of them tries to conquer the...
 
infantryfortifyboardterritoryhasbrocavalrydominationstrategyglobaltacticarmyriskconquercarddicebattleartilleryconquestreinforce
X-Treme Dock Gallery

Shareware by Flashtuning
3 x 1Kb downloads

...AutoPlay / AutoScroll / Previous / Next with global or individual timer for each image * Time...
 
actionscripthorizontaleffectsfullscreenautoplaytransitionsdock menuzoomas3slideshowgalleryrandomxmlverticalflashvars
InboxRULES for Rules

Shareware by ORNIC USA, LLC
1 x 13795Kb downloads

...as an addition it is possible to define global rules, which are common for all mailboxes....
 
outlookprint attachmentprimat emailsave messagesave emailprint messagesave attachmentextract message
WeFi For WinXP

Freeware by WeFi
24 x 5829Kb downloads

...to anywhere around the world, provided by our global mapping project of Wefi users. Each of over...
 
wefiwi-fiwirelesshotspotwardrivingrouterwifilocationwardriverwireless network
Private Label Energy Saver

Demo by Rebrand Software, LLC
4 x 2644Kb downloads

...With rising energy prices and the threat of global warming, everyone could stand to conserve energy. Unfortunately,...
 
shutdownenergy saversave energybrandableprivate labelmaster resell rights
Free Vista Files award
...file to all the ancestors in the GenCircles Global Tree. Instead of getting back useless hits, SmartMatching...
 
genealogychartsgedcomchartinglineagegeneologyfamily tree historypublish

Shareware by Pstruh Software
15 x 292Kb downloads

...a group Enumaration Domain servers enameration Local and global group enameration User enameration Group members and user...
 
passwordpropertiesenablelogonusersecurityaccount2000deleteenumeratememberdisablewindowsaddpolicyserverrasdomaingroupmanagerlogin
XML Photo Template 04 AS3

Shareware by Flashtuning
2 x 1Kb downloads

...template * AutoPlay / Previous / Next with global timer or individual for each image...
 
xmlautoplaynewsflash galleryflash templatevideofullscreenactionscript
KATE

Freeware by Haptek Inc.
27 x 2870Kb downloads

...K.A.T.E. IM Avatar Character System Leveraging the Global IPC, this application (code name KATE) brings together...
 
peoplecommunicatemorphputtychatavatarmessagesystemhapteksonorkcharactertextinstantspeechvirtualfriendsapi
Html Image Mapping Tool

Shareware by Software How to
20 x 7936Kb downloads

...html image maps by specifying map header, footer, global properties and area collection. Pictures mapping program can...
 
exportwebsitesavetoolbarkeywordphotographsgraphicshtmlwebpagepropertieslinkmappergridcodeeditcreateimagesareasoftwarephotoslistspastecopysearchpreviewpicturetext
Internet Explorer Password Recovery Wizard

Shareware by FSPro Labs
11 x 924Kb downloads

...The World Wide Web (WWW, Web) is a global information space. Lots of web resources like web...
 
pageinternet explorerrevealingpasswordsrecovery
Fast Hide IP

Shareware by Fast Hide IP
1 x 9682Kb downloads

...the Internet without the real IP. Fast-Hide-IP, a global advanced IP changer, offers high anonymous and secure...
 
hiderencrpt trafficprotect private
Active Network Monitor

Demo by SmartLine Inc.
8 x 1947Kb downloads

...(IRQs, I/O, DMA and Memory), users, local groups, global groups and so on....
 
windows monitoringnetwork managementauditingnetwork monitornetworks
FusionCharts for Dreamweaver (Designer)

Commercial by Extend Studio
5 x 4954Kb downloads

...FusionCharts for Dreamweaver is a product developed by Extend Studio in partnership with InfoSoft Global. We have created a Dreamweaver extension that brings the power of FusionCharts in Dreamweaver, and...
 
dreamweaver extensionanimated chartsdreammweaver commponentstdata plottingdata visualizationchartingweb chartshtml chartsflash charts
Radialix

Shareware by Radialix Software
5 x 43798Kb downloads

...ever these days with the need to penetrate global markets. Radialix 2 is a software localization tool...
 
software localizationvisual localizationlocalization tooldotnet localizationdelphi localization