Sort by : ReleasedNameDownloadsAddedRatingRelevance
EfreeSoft Boss Key

Freeware by EFREESOFT
264 x 661Kb downloads

...immediatlly using a hot key!You can hide the browser windows,folder windows,applications windows,all your desktop icons and taskbar...
privacyhideboss key
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Paessler URL Recorder

Freeware by Paessler AG
92 x 740Kb downloads

...Paessler URL Recorder helps to find out the URLs and POSTDATA strings that a user sends to a web server while surfing a sequence of URLs. It works like a...
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml

Freeware by CodeThat.Com
94 x 255Kb downloads

Free Vista Files award
...CodeThatForm package gives you full control over the windows in browser. You can control the style, appearance, content, positioning and sizing of the window. Creation of the windows never was...
javascript windowdgtml formjavascript form

Freeware by Iconico
80 x 341Kb downloads

...the EasyLogin bookmark will work in any modern browser - Tested on many websites including gmail, yahoo...
Sponsored Ad Blocker

Freeware by
78 x 3193Kb downloads

...Sponsored Ad Blocker™ protects the relevance of web searches by blocking often misleading and annoying sponsored search ads on Google, MSN, AOL, Yahoo and over 20 other search engines and...
browser extensionblockersearch
m9P Surfer

Freeware by mental9Production
127 x 2435Kb downloads

...Surfer is a very fast light weight web browser developed by mental9Production! This web surfer is extremely...
explorerweb browserinternetnavigatorsurfer
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...the web site like you would with any FTP client. Create new pages from scratch or copy...
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...NoSpamToday is a e-mail spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows combining the award-winning SpamAssassin filter, an attachment...
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server

Freeware by
74 x 995Kb downloads

...Save information from the Web in an organized manner. NetPicker gives you an easy way to save and organize information from the web. Featuring an intuitive interface, NetPicker allows you...
save informationweb information

Freeware by Scand
78 x 49Kb downloads You don`t have to care about the browser compatibility problems. dhtmlxToolbar works perfectly in all main...
toolbar builderdhtml toolbarweb toolbarjavascript toolbartoolbar creatorcustomizable toolbarjavascript componentweb developmentfree toolbartoolbar makejavascript navigationscandcreate toolbar
Pop-Up Stopper

Freeware by Panicware Inc.
170 x 414Kb downloads

...Block Netscape, Internet Explorer, Mozilla and desktop pop-up windows with the latest upgrade of this small tool, now with added support for Mozilla, and new technology to block annoying...
stop pop-upsstop popupssurfingx10popup stopperpopup windowspopup killerinternetpop-up stopperfiltereliminate popupspop underpop-up killerpop stopper
Active Web Reader Customizer

Freeware by DeskShare
55 x 59Kb downloads

Free Vista Files award
...With the Active Web Reader Customizer you can now distribute your own RSS reader that includes your feeds and web pages. The user then simply downloads your custom RSS reader,...
customizable rss aggregatorbranded rss aggregatorcustom rss reader

Freeware by Arovax LLC
135 x 1685Kb downloads

...the registry, hijack or install itself into a browser or find any other way to stealthy get...
security disablerstrojan virusessecurity breachsecurity vulnerabilitylive monitorkeystroke monitorsspyware monitoradwarebrowser hijackerssystem monitorspage hijackersfirewallspyware threat
RSSOwl - Powerful RSS / RDF / Atom News Feed Reader

Freeware by RSSOwl
125 x 4000Kb downloads

Free Vista Files award
...RSSOwl is a free RSS / RDF / Atom Newsreader in Java using SWT as fast graphic library. RSS ("Really Simple Syndication" or "Rich Site Summary") is a document specification that gives...
aggregatorfeedaggregatorjavafeedreadereclipserdfopmlopen sourceswtatomportablenews readerrcprssnewsreadersnewsaggregatorfreenews aggregatortraycross platformsynchronizationnewsaggregators
Cayman Browser

Freeware by
77 x 1677Kb downloads

...your Internet surfing with this tabbed, innovative Web browser today! Cayman Browser incorporates a large collection of...(includes up to 35 languages). *Mouse gestures: Command browser with small mouse movements easily *Built-in popup killer:...aloud in any of 10 languages *Skin: Cayman Browser supports creative skins for the program; *Safe Recovery:...If Cayman Browser is closed improperly, all open web pages are...
PixGrabber Free

Freeware by SoftInform
74 x 4296Kb downloads and bookmark it straight from the active browser window. PixGrabber blocks ads and pop ups guided...
image viewerimage browserstopperimage archivebookmark managerpop-up killerinternet surfing

Shareware by Stormdance
67 x 1379Kb downloads

Free Vista Files award
...preview your work in progress in a web browser at the click of a button. There`s even...
localisingwebtranslatortranslatingcatscradletranslationlocalizationlocalisationlocalizingweb pageweb page editorhtml

Freeware by Moog Software
134 x 18000Kb downloads

Free Vista Files award
...even on DHCP dynamic-ip internet connections and the browser accessible server allows a quick download of a...full featured web client from any standard internet browser when in restrictive internet cafes....
http proxyremote accessremote control softwareremote computer controlremote administrationtelecommutingremote administrator

Freeware by
147 x 648Kb downloads

Free Vista Files award
...Now you can watch over thousand live worldwide channels (1700+) on your PC, free of charge. TV is an extremely easy to use application and anyone can find their own...