Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...a rich browser-based interface. Access all groupware functionality from anywhere using a standard web browser.The Outlook Connector...tasks, calendar events, notes and journal items between Outlook (2002/2003/2007) and the Groupware server. Any standard POP3...and publish documents online. Access the document storage from a browser, FTP/FTPS client, or WebDAV folder. Active...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
SMSCOUNTRY SMS Mail Box

Freeware by SMSCOUNTRY
392 x 2744Kb downloads

...You can send sms from Microsoft® Outlook® and it is as simple as...Messages to almost any wireless device worldwide directly from your desktop PC via Microsoft® premier messaging client:...versions. Features: 1. Use existing address book contacts from Microsoft® Outlook®. 2. Simultaneously broadcast SMS messages to...
 
email smsmobilesms toolsbulk smssms softwaresms from outlookfree sms
...Trivial Proxy is a small application that allow to see and log network activity of the any applications(browsers, email clients etc.). So what does that mean in English? Simple,...
 
proxylogtunnel
Advanced SMTP Server

Shareware by IM-Soft
589 x 14208Kb downloads

Free Vista Files award
...Windows that lets you send email messages directly from your computer to recipient mailboxes. Along with a...Advanced SMTP Server supports all email programs like Outlook Express, Outlook, Eudora, etc. The email program you...
 
smtpmailfreemailingbookemailmassaddressmailere-mailbulkremailerbomber
RapidSMTP Free Edition

Freeware by RapidSMTP.com
72 x 10904Kb downloads

Free Vista Files award
...RapidSMTP is an award winning high-performance e-mail marketing software to create and send personalized marketing e-mails. Send e-mails at any speed your project or company requires....
 
mailingnewslettersgeolocationmailinglistemailmysqlmarketingsendbulkemails
Random Signature Changer

Freeware by den fete gjengen
65 x 230Kb downloads

...the name suggests) let it randomly find one from the databases. It can also set the song...as long as the client supports reading signatures from an external text file....
 
expresse-mailclientwinampoperaoutlookthunderbirdemailsignature

Freeware by Comodo Inc
93 x 10370Kb downloads

...easy-to-use, client-based software product that eliminates spam forever from the computer`s email system. No license fees -...
 
free antispam toolfree antispam softwaredesktop antispam toolantispam free download
M8 Free Multi Clipboard

Freeware by M8 Software(UK)
106 x 7006Kb downloads

...and it captures everything you cut or copy from other programs. It keeps up to 500 clips....press Alt+PrtScr - To capture an individual graphic from Internet Explorer or AOL, point to the graphic,...right click and select "Copy" from the drop down list. M8 also allows you...
 
multiclipboardscreen capturemulti-clipboardscreenshotscreen shotmulti clipboard
Cactus Spam Filter

Freeware by Codeode
112 x 634Kb downloads

...looks to the preferences of the individual, you. From your guidance, CSF intelligently learns to distinguish good...e-mails from spam. After a short while it knows you...and can effectively in the background relieve you from the spam burden. Just as any good friend,...tested with these e-mail clients: Microsoft Outlook, Microsoft Outlook Express, Netscape, Opera, Mozilla, Mozilla Thunderbird, Eudora, Pegasus...
 
filtercactuspegasusbayesianmozillaspamoperafreeincredimailexpressnetscapeoutlookthunderbird
PC SMS - Outlook SMS

Freeware by ComUnified.com
467 x 5273Kb downloads

...SMS directly from your PC, Outlook or Outlook Express to any GSM compatible phone. Key Features:...- integration with Outlook or Express addressbook - send to mulitple recipients...service please mail support@comunified.com Full Integration with MS Outlook and MS Outlook Express. Message status information through...simple web interface. Perfect integration into the MS Outlook and Outlook Express look and feel. Encompassing help...
 
windows 2000internationalexpresssmswinxpsimstext messagessend smscomputerwindows 2003text messagingemail-smsdesktopvia outlookcomunifiedwin2kinternet
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...Windows that lets you send email messages directly from your computer. It`s very simple but very useful...Free SMTP Server supports all email programs like Outlook Express and Eudora, but best optimized to work...with Outlook Express. The email program you already use for...
 
bombersmtpfreemailerbookemailbulkaddressremailermasse-mailmailing
.::Anonymous Guest - Proxy Checker, SOCKS Manager::.

Freeware by SPS-Group
149 x 7034Kb downloads

...working speed. Supports interaction with Internet Explorer, Opera, Outlook Express, ICQ and other popular programs....
 
serverchaintestcheckertoollistprivacymanagerproxyinternethttpsoftwareanonymityconnectprotectionsocks4firewallanonymizerhttpssecuritysocks5
Shark Email Extractor

Freeware by Logambo.com
249 x 440Kb downloads

...addresses and it automatically extract all e-mail addresses from those file(s).You can search your entire system if...you like, from your local hard disk drive to Network, MS...websites, if you want to extracting email address from a website you can use our SharkMailHunt software....
 
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber

Freeware by Reunion.com, Inc.
54 x 121Kb downloads

...losing touch with people? Add Reunion.com features to Outlook or Outlook Express and Keep in Touch automatically....you`ll be able to get hassle-free updated information from anyone in your address book, import and consolidate...contacts from leading web-mail clients (Yahoo!, AOL, GMail, Hotmail, MSN),...
 
contact updateroutlook plugincontact managementreunionkeep touchoutlook expresspeople searchautomatic updategoodcontactsupdate contacts
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
114 x 29442Kb downloads

...English language. TheSage can look up words directly from almost any program (IE, Word, Firefox, Outlook, Thunderbird,......
 
speechword listspronunciationdictionarylookupthesageone-clickthesauruswildcard searchconcordancerenglishanagram
Acubix PicoBackup for Outlook Express

Freeware by Acubix
66 x 3453Kb downloads

...PicoBackup Outlook Express Edition is an easy-to-use Outlook Express emails backup utility packed with many powerful...
 
restoreaesblowfishsecuritycompressbackupburningencryptionemailoutlookdecompressdvdftpexpresszip
SpamAware

Freeware by JAM Software GmbH
58 x 14619Kb downloads

Free Vista Files award
...spend more time on sorting out good mails from spam. Don`t waste time on this let SpamAware...for you! SpamAware is a plugin for MS-Outlook, Outlook Express and Windows Mail (Vista). It uses SpamAssassin...and is able to automatically add all your Outlook contacts and add recipients of mails you write...
 
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
EssentialPIM Portable

Freeware by Astonsoft Ltd.
144 x 13083Kb downloads

Free Vista Files award
...entries and contacts. Offers AES 256-bit encryption, MS Outlook import/export, search capabilities and versatile print features. EssentialPIM...Free Portable works straight from your removable media....
 
personal organizeroutlinernotes keeperpimfree pimpersonal pimpersonal information managercontacts keeperschedulerdayplannercontact managerdaily organizer
EssentialPIM

Freeware by Astonsoft Ltd.
125 x 11243Kb downloads

Free Vista Files award
...entries and contacts. Offers AES 256-bit encryption, MS Outlook import/export, search capabilities, versatile print features, and adjustable...
 
contact managerschedulerdayplannerpimoutlinerpersonal information managercontacts keeperpersonal pimpersonal organizerfree pimdaily organizernotes keeper
SPAMfighter Standard

Freeware by SPAMfighter
450 x 2529Kb downloads

Free Vista Files award
...stand alone, anti-spam and anti-phishing tool for Outlook, Outlook Express, Windows Mail, Windows Live Mail or Thunderbird....
 
microsoftthunderbirdjunkantispameatermailfilterantipuboutlookfreeanti-pubphishingblockerspamkillerspam filterfreewarejunkmailspammersspammingexpressmozilladownloads