1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...entirely by you not the software The webmasters tool will only pre-populate web pages and not auto...over 160 RSS, PAD, Blogg, Podcast, Shareware and Freeware sites. With the webmasters tool you will never...waste time and money on targeting the wrong keywords again. The webmasters tool is able to check...Google for the amount of site targeting a keyword and return a ranking based upon a percentage...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
e3KWD Check

Freeware by e3internet
25 x 918Kb downloads

...e3KWD Check is a lightweight, fast and free SEO (search engine optimisation) multilingual tool for analysing...has been written for all Windows platforms. This tool allows you to run real time keyword density...languages can be added by the user. This tool has been designed to allow the focus to...
 
kwd toolkeyword density checkerseo toolkwd checkersearch engine optimisation
evolvEd

Freeware by David Gabrielsen
41 x 933Kb downloads

...evolvEd® is a FREE general purpose text editor useful for web-developing, programming...yet another computer application. Your experience with other tools should be relevant to each new application, making...simply need a powerful replacement for Notepad, a tool for editing your web pages, or a programming...Basic, XML) -Keyword Editor which lets you modify/create keyword definitions -Automatic Function Help for almost every function...
 
htmlcgihighlightfreecasdadingcobolstreamservenotepadjavasimulaevolvedtext editorawkdelphihtml editorphpstyle sheetssyntaxcssperldeveloppascalxmlhexprogramasp
Jvw Google rank and pagerank finder

Freeware by Jimmy`s Value World
29 x 350Kb downloads

...A free search engine optimization software by Jvw at google-ranking.info....ranking, Pagerank and more... This software is easy-to-use tool to automatically check a domain`s PageRank. It is...ideal tool for finding valuable domains. PageRank is Google`s way...
 
searchfreesoftwareengineoptimization
Domain Name - Analyzer & Generator

Freeware by HostingDude.com
32 x 506Kb downloads

...and checks availability of multiple versions of those keywords in various combinations, with and without common pre-fixes...for as little as $4.95 per year. Totally FREE software. No spyware. No nagware. No donation requests....
 
domain namesfindname spinnergenerateregisterdomainscreate
...This tool will get you creating effective & professional looking...no time! You can download your you 100% free copy at any time. It eliminates all the...a fresh looking template. Software Features: - 100% Free - Supports Windows 9x/ME/NT/2000/XP - Full Keyword Support...
 
html utilityhtml wizardhtml generatordescriptionkeywordstagshelper
Free Vista Files award
...Tracker - a push-button solution to day-to-day extensive keyword tracking. Rank Tracker is the kind of SEO...and efficiently. Besides, Rank Tracker is a top-performing keyword research tool that incorporates 19 different keyword suggestion...mechanisms to provide the most exhaustive list of keywords for the niche you target. And, it does...a number of tasks that very few keyword trackers in the industry can do: - It...
 
website promotionseo softwarekeyword suggestion toolautomatic ranking checkerrankings monitoring toolsearch engine rankingsrankings check
...weblink and file manager that also includes intelligent keyword search. plus free web link content (business, home,...
 
link managerbrowser toolsweb browsertopicsbookmark managerplugins
DeskTools

Freeware by Dinit Softwares
70 x 1408Kb downloads

...DeskTools is a tool that can toggle AlwaysOnTop, hide and minimise ANY...System Tray. You can also make applications transparent! DeskTools comes in a package with a lot of...other powerfull tools like CritHide (hide all application containing a particualr...
 
dinit softwaresprakhar birlaalwaysontopalways tophideaotsend traytransparent
ImageFans

Shareware by Klonsoft
16 x 723Kb downloads

...finder and image downloader. This powerful image search tool can collect hundreds of graphics from the web...search engine to find web pages for your keywords specified, downloads all images from those pages, and...
 
image spiderjesus imagecolorful imagefunny imagefree imagefunny picturejpeg imageanimal imagecartoon imagedragon imageghost imagefree downloadimage searchfree background imageanimated gifsmotion picture
Page Promoter

Shareware by NetPromoter
17 x 7077Kb downloads

...ultimate URL registration, search engine optimization and promotion tool for submitting Web sites to thousands search engines...is updated on a regular basis. Features include Keyword Tracking and Ranking utilities, Page analyzer, Robots.txt and...Popularity Analyzer modules, Emailed Reports and more. The Keyword Generator module is designed for querying the world...search engine databases for the most used keyword queries used by Web surfers.
 
site submissionurl registrationsite optimizationseo optimizationsite promotionsearch engine submission
RSS Submit

Shareware by ksoft
24 x 4061Kb downloads

...right from within the software. RSS Preview and keyword analysis lets you manage your feeds in real...time. Download our FREE 12 day trial and add up to 3...RSS feeds for submission. Registered users also receive FREE updates as new RSS feed search engines are...
 
news feedsubmit rss feedxml submitrss submitsubmit xmlxml feedrss search enginerss feed submit
CodedColor PhotoStudio Pro

Shareware by 1STEIN Corp.
25 x 58000Kb downloads

...resize & resample images, jp2000, batch conversion, database keyword searching, red eye removal, color / sharpness /...Visit CodedColor.com to learn more and download a free copy! Includes BYNGO MMS messenger and Pixpedia Publisher,...
 
acdseealbumexifimageconversionthumbsmultimediagraphicsbalancetifphotogpseditorpanoramaprintpublishbmpbatchpdfviewerdtpjpgorganizegifjpegflashrawcameraiptcarchivepicasawmfcatalog
Accurate Monitor for Search Engines

Shareware by CleverStat
19 x 3566Kb downloads

Free Vista Files award
...is probably the most comprehensive search engine optimization tool for professionals and semi-professionals. See for yourself. First,...this tool monitors website position by keywords and phrases on all popular search engines, not...regularly. Second, when providing results, it displays both free and paid listing results, showing you the full...for Search Engine is a smartly designed professional tools intended for heavy “industrial” use.
 
googleweb siterankpositionaltavistaoptimizationyahoosearch engines
KeyWord Generator lite

Freeware by Oksima team
33 x 138Kb downloads

...KeyWord generator is free powerfull tool to generate keywords and save them. Using KeyWord generator lite you...can generate more than 100 keywords and use them in your meta tags, titles...or content of your web page. Keywords are really powerfull way to make search engines...remember about you. Meta keywords can be extremely effective if they feat content...of spam keywording. Awoid repeating of the same keyword too often.
 
keywordsrequest trackerselectionsmeta keyword generatorrt2link popularitykeyphrasegoogle keyword generator
Quick-Type

Demo by WCCL
26 x 483Kb downloads

Free Vista Files award
...pieces of text you type, along with a keyword for each of them. Then whenever you type...that keyword in future, it gets replaced with your text......
 
quick-typeimprove typing speedtype quicktips help speed typingfree speed typing programtyping software programsfaster typing exercisestips for typing fasterspeed typing aid
RoboAuthor

Shareware by Visual Vision
34 x 4055Kb downloads

Free Vista Files award
...source file; - easy Table of Contents; easy keyword list; topics (pages) easy to add and to...and footers; - CHM or HLP file is free for distribution, i.e. no royalties; - easy to...
 
create helpfileapplication help systemmanage software documentationhtmlhelp documentationmake winhelp hlpsoftware help systemprogramcreate html help chmapplication documentationcreate help systemcreate documentation
TrafficTrapper Marketing Tool

Demo by George Karamesinis
31 x 4789Kb downloads

...TrafficTrapper Is The Marketing Tool That Creates Thousands Of Laser Targeted Marketing Pages...RSS Technology.New Powerfull Random RSS Engine. System requirements:PHP4. Free Demo Is Now Available For Download....
 
marketingtooltraffictrapper
IEHistoryX

Shareware by 585Soft
32 x 467Kb downloads

...Cookies created from 02.14.2006 to 02.16.2006) or by keyword in the page URL or page title (for...`gift` for `Buy the GIFT`, `download` for `DOWNLOAD free software`). Using keywords you can also find and...Excel document for later use. AutoComplete form information tool helps you to view, export, copy to clipboard,...
 
autocompletion formstyped urlsindividualsearch historyselectivelycompletelyaddress bar historydelete cookiesclear history
Hello Engines!

Freeware by AceBIT
16 x 9233Kb downloads

Free Vista Files award
...Hello Engines! is a multiple award-winning optimization tool which helps you to identify all the weaknesses...order to achieve a better ranking for specific keywords and keyword combinations. Select a primary search engine...for which your website should be optimized. Integrated tools like the HTML Editor, Link Checker and Robots.txt...Engines! you can ensure that your website is free of technical errors and achieves a better ranking...
 
promotionsearch enginesoptimizingwebsite registrationoptimization softwaresearch engines optimizationhtml checkeroptimization toolrankingsubmissionseourl registrationweb promotionautomatichello engines