1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

Sort by : ReleasedNameDownloadsAddedRatingRelevance
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
..."Wow, you really made that?" Consider the HTML Editor your new best friend. HTML veterans, you`ll create...you`re doing things right. That`s why the HTML Editor comes with three different tools to correct human...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Falco Image Studio

Freeware by Falco Software Company
61 x 23301Kb downloads

...Falco Image Editor is a Graphics Tool to create, edit and...export images. Create professional looking images with ease. Key features: 1. Loading from BMP,...Copy/Paste in Multiple Windows. 5. Paste from other Image Editors, such as MS Paint, etc. 6. Pencil,...Selection Tool, Color Selection Tool, Lasso Selection Tool, Free Hand Selection Tool, Ellipse Selection Tool, Hue Selection...
 
image studiofalco image editorfalco image studio
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...Image Eye is a fast - and free - image viewer with a nice clean user...interface. Feature high-lights: - The only image viewer you need for viewing and browsing images....menus and toolbars wasting desktop space. - Uncompromising image quality. - Small and very fast, highly tuned...code. - Reads all common image file formats. - Image index feature with very...read finish.
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
602PC SUITE

Shareware by Software602, Inc.
61 x 28195Kb downloads

...functions and ODBC support. 602Photo is a photo editor designed for digital camera and scanner image editing...
 
digital imagingknowledgeexcelproductivityeditorworker602prosmall business602softwareoffice suitexlsspreadsheetfree downloadopenofficesoftware602602textphotoprocessordocumentalternativemicrosoft word
VCW VicMan`s Photo Editor

Freeware by VicMan Software
168 x 5010Kb downloads

...Now with all PRO features. With this free easy-to-use image editor, you can turn your snapshots...of art, as well as draw your own images using its built-in image enhancement functions. Select a...any picture. The program supports more than 20 image formats. The distortion tools offer more than a...
 
graphicsresizebrushphoto effectfish eyephoto suittextfree photo editortwirlimprove imagedrawedit photophoto filteredit imagecorrect imagefree image editorcroppencilcorrect color
1site (LITE)

Freeware by Visual Vision
54 x 1937Kb downloads

Free Vista Files award
...Leading professional and easy to use integrated Web editor and Web publishing tool. You can make fancy...-  plugin capabilities (e.g. 3D Buttons) - automatic image gallery / photo album / thumbnails generation 1SITE...while creating your websight. The LITE edition is free and is fine for small websites (up to...
 
sigthwebsigthcreate internet pagescreate web pagecreate web siteweb page editorweb editorweb authoring softwarevisual html editorwysiwyg editorsightcreate sitesweb publishingwebsightweb publishing software
Frigate3Lite

Freeware by Helmsman
47 x 5200Kb downloads

...audio/video file player/viewer and MP3 tag editor. Use images in daily operations? Great, because Frigate 3 comes...with an image converter and a viewer with thumbnail and slideshow...are sure to appreciate built-in Hex editor, DBF editor and HTML viewer, as well as other handy...meaning you can turn off any viewer or editor you don’t need. Likewise, you can take advantage...
 
directoryfile manageftparchiveexplorerfolder
PixMatrix

Freeware by Tufala LLC
37 x 5609Kb downloads

...WYSIWYG HTML editor, spell checker, built in batch image editing, thumbnail creation, FTP with presets for the...and extensive help movies. Tufala LLC keeps PixMatrix free by displaying family friendly ads at the bottom...
 
free web albumfree image galleryfree photo sharingfree web photo albumfree photo album softwaredigital images
TreeDBNotes

Freeware by SoftViewer
50 x 7995Kb downloads

...TreeDBNotes is a free powerful and easy-to-use personal database program, e-Book, PIM...
 
text converterpasswordpimtreenotesnotepadtreedbnotesencryptiontreepaddatabasetree notestext editorhtml editor
Blockstar Website Builder

Freeware by Blockstar.com
27 x 5436Kb downloads

...host your site for you. Blockstar offers both free and paid web hosting solutions. Our Free Hosting...Superstar Hosting plan provides domain name hosting, ad free websites, 200MB of storage, 4GB of monthly bandwidth,...only $3.95 a month. From uploading a single image to making a full website, Blockstar can put...
 
make your own websitewebsite builderhtml editorcreate websitewebsite creator
BibleDatabase

Freeware by BibleDatabase
40 x 4283Kb downloads

...by Chapter, Cut, Copy and Paste Text and Images from BibleDatabase to other Windows Applications, Maps and...
 
concordanceholy scriptureschristian gospelprayer diarynivprayer journalnrsvcommentarybibledatabasefree downloadjesus christnasbbbebible dictionaryasvfreewareword processorfree bibles downloadbiblical maps
Diji Album Viewer

Freeware by Xequte Software
41 x 1805Kb downloads

...can be created with the Diji Album Editor, free download at http:/www.xequte.com/dijialbum/index.html Diji Album files resemble real...
 
digita lphoto albumfamily albumwedding albumimagephoto album softwarecamera softwarewedding photo albumdesktop publishingphotograph albumphoto softwareflip albummultimedi aalbumpicture album
...then merge them back with ease. - Built-in image viewer with the slide-show capabilities. - Full-featured text...version is fully functional and comes with a free 30-day license for the full use of the...
 
explorer replacementfile managerwindows shell enhancementcommander
Diary Book

Freeware by TSM-Soft Enterprise
62 x 2062Kb downloads

...the main program and also changing the background image for the large diary editor. You can also...added; making it a very enjoyable and popular free diary-keeping tool. 12 May 2005 added category support...
 
reminderhtml diaryweb diarywritenotesalarmpersonal diarye-bookto-dotextpassword protecteddiary booktodonote editorpimfile encryptjournal

Freeware by t@b
131 x 2625Kb downloads

...wave forms. Input is primarily avi, wav, and image files. Output includes avi, wav, jpg, png, bmp....
 
bluescreeneditingmulti-trackgreen screenmulti trackzwei-steindistortion effectszoomeditorvideo compositinggreenscreenchroma keyblue screenpanzs4freecompositordistort video
Photo Pos Lite image editor

Adware by PowerOfSoftware Ltd.
57 x 14669Kb downloads

...Photo Pos Lite (Image editing software) is a free ad-supported (WhenU ad-supported) edition of the award-wining editor...Pos Pro features it is still a powerful Image and Computer Graphics editor. Using the Lite version...it to another format and much more. The editor also includes some great drawing and painting tools...Support of scanners and digital cameras, Various of Image Enhancing and editing tools and functions, Paint Brush...
 
digital photographyscanfiltersprintbrushesmasksphoto editorpaintlayersdrawbatchphoto editing softwarescriptsadd framesenhancingimage editorimage editing softwarespecial effectscomputer graphics
Pixel Editor

Shareware by Icon Empire
45 x 6511Kb downloads

...Pixel Editor is new software to work with images. It...want good pictures for your mobile, so Pixel Editor gives you all the tools you need. With...you`ll be able to create and edit small images in either standard, or custom sizes, in color...million colors, to create and edit semi-transparent PNG images in 32-bit color depth with 8-bit alpha channel...and even more. Pixel Editor has an arsenal of specialized tools for working...
 
glyphgraphiceditimageeditorpicture
Advanced Explorer

Freeware by Scriptol
30 x 468Kb downloads

Free Vista Files award
...Advanced Explorer is free and is: A complete file manager with secured...of directories, and so one... A text and image browser for lots of formats with builtin tools...
 
advancedfilecopytextbrowsermanagerhtmlpageeditorzipwebburnergeneratorexplorerimage
DrawPad Graphic Editor Free

Freeware by NCH Software
13 x 571Kb downloads

...and Create Graphic Images. DrawPad is an easy-to-use image composition and manipulation program, and an essential tool...pencil and brush tools, raster and vector images, image layers for non-destructive editing, and effects such as...jpg, gif, pdf, and svg formats. DrawPad Graphic Editor Free Features: *Pencil and brush tools for drawing,...and painting *Work with both raster and vector images *Image layers allow for...
 
drawingeditcreategraphicsgraphic image editorpaintdrawing softwareimagesgraphic editorfreeeditingsketchpaintingsketchingdesign
PaintStar

Freeware by Zhenzhou Wang
88 x 2640Kb downloads

...Transformation tools including rotate,scale,shear,perspective,flip,and wrap. Auto antialias supported. Image Morphing supported. With this technique, you can create...sequence of intermediate frames that seamlessly transform one image to another and generate output in a form...of gif animation or image file sequence. Gradient Fill tools include linear,radial,square,conical(symmetric),conical(asymmetric) and...area to be captured.
 
freewaremorphlayerpathscreen captureimage editor