1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...Flash Media Player is a handy flash tool kit designed as Macromedia flash player and...manager. It has several powerful flash tools: preview and browse flash movie, capture flash...image and set it as wallpaper, create flash screensaver with ease, make conversion between SWF and EXE...enhance and extend the using possibility of existing flash files. And with friendly user interface, Flash Player...
 
flash screen saverflash kitmacromedia flash player
Flash Player Pro

Shareware by FlashPlayerPro.com
111 x 40694Kb downloads

...Flash Player Pro is a handy flash tool kit designed as Adobe flash player and...manager. It has several powerful flash tools: download flash movies, preview and browse flash movie, capture flash...image and set it as wallpaper, create flash screensaver with ease, make conversion between SWF and EXE...enhance and extend the using possibility of existing flash files.
 
flash screen saverswf playermacromedia flash player
AtPresent Recorder

Shareware by AtPresent Software
31 x 692Kb downloads

...and automatically make a project to build interactive Flash based simulation, presentation, demo, tutorial. Use it separately...a comfortable tool to prepare HTML sequence with screenshots for your program. Define recording interval, record full...not equal sequential screens, look through sequence of screenshots and delete those you don`t like, define area...
 
presentationcapturemovierecordingjavatrainingdesktopinteractionrecordercapturingsimulationtutorialscreenshotflashdemo
27 Tools-in-1 Wichio Browser

Shareware by Revopoint Co., Ltd.
18 x 6685Kb downloads

...notifications) by saying anything you want. Wichio features Screen Capture (multiple captures without pasting), Download Manager (for...
 
reminderflashtranslateprivatehistorye-mailresourcelyricnetstatdictionarycookiesscreenupdatespeechfillerrefreshtraceroutewhoismapdnsvoicecurrencycacheblockalertcaptureweather
AtPresent Recorder Pro

Shareware by AtPresent Software
24 x 11160Kb downloads

...Record user activities from your computer screen and save it in Flash format in minutes!...Set recording interval, record full screen or particular area, catch mouse position, pointer type...and clicks, edit and scale captured content, add mouse tracing and curve path, extra...record inside already captured screenshots sequence, define playing speed on the timeline, burn...your copyright, etc.
 
recorderinteractionflashtutorialjavacapturingdesktoppresentationmoviecapturerecordingtrainingscreenshotsimulationdemo
Demoshop

Shareware by Mandsoft
42 x 5586Kb downloads

...Demoshop contains the following components: Screen Recorder: The screen recorder component can record all activities in full...add various cursor and text effects during recording. Screen Video Editor: Once you`ve finished recording, you can...image, highlight. And finally, you can export the screen video to various formats such as Adobe Flash...and AVI. Screen Video Codec: The Mandsoft Screen Capture Codec (MSCC) provides lossless...
 
screecamsoftwarescreen recordernanodemovideo capturescreen demoscreen capturefree
CodedColor PhotoStudio Pro

Shareware by 1STEIN Corp.
25 x 58000Kb downloads

...artefacts removal, clone brush, scanner & TWAIN import, screen capture, lossless JPEG rotation, gamma correction and screenshows...automatic white balance, skype photo sharing, CD/DVD burning, flash album export, new RAW formats, GPS tagging, 50...
 
acdseealbumexifimageconversionthumbsmultimediagraphicsbalancetifphotogpseditorpanoramaprintpublishbmpbatchpdfviewerdtpjpgorganizegifjpegflashrawcameraiptcarchivepicasawmfcatalog
DemoCharge

Shareware by YesSoftware, Inc.
26 x 7347Kb downloads

...emails, documents and Help files by replacing static screenshots with GIF animations recorded by capturing your desktop....DemoCharge allows you to capture screen activity to create animated demos and content for...animated demos in minutes: - Casual users can capture problems live and email them to support, -...
 
trainingdesktopdemorecordknowledge basesupportdocumentationsoftwarepresentationgifscreenanimatedtutorialcapturetestingdocuments
Free Vista Files award
...Easily build a professional Flash Website presence without coding. Blueframe Web is a...unique technology which gives you 60 Flash website templates, plus an easy-to-use WYSIWYG authoring software....and be selling your products online in minutes Screen capture any image to the correct size and...
 
editorispmake websitecreate websiteadobebuild websiteiphonetemplatesprogramsflashsoftwarehostingtouchipod
...buy expensive website software to create your own Flash website. With Auora Website you get 4 Flash...images with your own or use the special screen capture feature. Change main text font, color, size...easy. When you have finished building your new Flash website, simply drag-and-drop your files to your server...
 
softwareflashtemplateshtmlprogramsmacromediawebsitephotoeditor
Copysafe Web

Commercial by ArtistScope
23 x 2671Kb downloads

...and images from all methods of copy (including Printscreen and screen capture). Copysafe Web includes all of...Image plus the Copysafe Web plugin to trap capture methods. Copysafe Web images and pages can be...content including text and other material such as Flash movies and Pdf files. Individual pages can also...is the only solution for protection from ALL screen capture! Run from the Windows Gui or run...
 
protect web siteprevent printscreenprotect picssecure imagescapture safeprotect photosprotect imagecopy protectstop screen captureimage encryptioncopy safeprotect web page
The Lock

Shareware by CrashCourse Software
34 x 41338Kb downloads

...access in any Windows application. Restrict access to screen capture via the Print Screen key. Logging features...
 
hippathelockaccess controlfolder securitysarbanes-oxleyfile securityaudit logprotecectioncomputer protectiondesktop lockuser monitorthe lockcomputer lockwindows securitysystemnispomregulation compliant
Dream FlashSee

Shareware by Dream Soft
32 x 1660Kb downloads

...Dream FlashSee is a powerful tool to browse, find, convert...(swf to exe, exe to swf, swf to screen saver) and Manage Flash Movies quickly and easily!...Now you can browse Flash movies in your computer, view them in list,...easily and quickly. You don`t need to load Flash movies one by one in your browser any...more. You can search Flash movies with filename,version, rate and size etc and...them in thumbnail form.
 
create screen savermake screen saverflash screen saverbrowse flash thumbmacromedia flash playercreate screensaverflash movieconvert swfflash applicationconvert flashexe swfswf exeswf fileswf2exeexe2swf
WinFast Capture

Shareware by www.ycysoft.com
30 x 1524Kb downloads

...1).Capturing Screen images There are Four ways you can use...to copy an image from your screen: - Capture a Region - Click and drag to highlight...of the screen, then release to capture... - Capture a Window or an Object - Dynamically captures...windows object/ Auto Scroll / Menu time-lapse... - Capture the Foreground Window - Capture the Foreground visible...window screen area whith on click.
 
capture screensave imagesdownload swfview imagesedit imagespick colorsnag screenscreen capture
WSnap

Shareware by escomtools.com
31 x 1180Kb downloads

...Wsnap is a screen capture tool that will help you take snapshots of...elements of the screen, including 3D games and Flash animation. It combines a handful of features, including...the abilities to capture the entire screen, windows, controls, cascading and floating...the settings, as well as automation of after capture actions is available....
 
capture gamessnapshotscreen recordingscreen capture softwareprint screencapture directx opengl gamesscreenshotscreen print
ACA Capture Pro

Shareware by ACA Systems
36 x 1894Kb downloads

Free Vista Files award
...ACA Capture Pro( http://www.acasystems.com/en/screencapturepro/index.html ) is a professional screen capture software on Windows, it allows you to...quickly capture screenshots including desktop, scrolling web pages, web images, menus...pressing a hotkey. In addition, you can apply capture masks, including circular, rectangle and other shapes, Captures...such as Word, Excel and PowerPoint.
 
video capturescreen printdirectxscreen recordersupercapturescreen recordingsnapshotscreenshotaca capture proprint screenprofessionalfreewarescreen capture softwaregame capturescreencamtechnical writingstandard
Save Flash Player

Shareware by www.ycysoft.com
36 x 2022Kb downloads

...Save Flash Player is a handy flash tool kit designed to Download and Play Macromedia...flash movies. It has several powerful flash tools: download flash files on the webpage and...temporary Internet folder , Quick preview and browse flash movie, capture flash image and set it as...wallpaper, create flash screensaver with ease, make window .EXE program, make flash...
 
swf playerflash htmlsave swfdownload flashflash playerflash make exeflash screensaver make
e2eSoft VCam

Shareware by e2eSoft
92 x 11104Kb downloads

Free Vista Files award
...use it to set images, animations, video clips, flash movies, DVD and even your desktop screen as...easily; - Support Image, flash, video file, video capture device and text transparent overlay; - Many cool...- Face tracking & smart move effect; - Screen capture, support hotkey, zoom, full screen capture and...
 
camsplittershare videosoftcamvirtual camerawebcam splitterscreen capturefake webcamvideo chat
ViewletBuilder

Commercial by Qarbon
31 x 47586Kb downloads

Free Vista Files award
...users to take a series of completely editable screen captures that are then animated to produce a...flawless Flash simulation. ViewletBuilder`s unprecedented ease of use, fast creation...
 
flash tutorialflash movieflash animationhelp desk softwarepresentation softwarescreen shotscreencastingscreen capture
ECTI

Commercial by FPU
34 x 9382Kb downloads

...support, learning... Taking screenshots, capturing mouse movements, images, Flash animations, Shockwave 3D contents to create movies that...demonstrate to utilization of your software, you can capture screenshots and mouse actions within your application and...enriches the sequences of contextual comments, pictures, links, Flash or Shockwave 3D animations... Audio comments and audio...
 
training softwarepresentation softwarescreen capturesupportmultimedia presentationtutorialauthoringscreen recordingsimulationlearningscreen shotdocumentsoftware demoeditorvirtual home tourhelp desk software