1 2 3 4 5 6 7 8 9 10 11 12 13 14

Sort by : ReleasedNameDownloadsAddedRatingRelevance
APSW InAFlash

Freeware by All Purpose Software
68 x 4198Kb downloads

...APSW InAFlash is the great software tool to enable you...(flash) files. It enables you to view all Flash animations from web pages, including Flash game sites,...Flash animations, Flash MTV, Flash Movies, Flash websites, Flash advertisements, or any Flash files you come across...to do is simply choose your file, download Flash file to any destination you choose on your...
 
capture flash gamedownload flash gameflash downloadflash capturedownload flash filesdownload flash mtv
...what the season is all about. The slides capture the true essence of the season. Download this...
 
desktopgoodjoyfulfestivallovexmassnowwallpaperessencewishesflashhappywinterchristmas
GetBot

Freeware by GetBot
35 x 321Kb downloads

Free Vista Files award
...to avoid duplicates. Get Anything: Movies, music, and Flash animations that play automatically on a page can`t...
 
resumeparsedragcrawlwindowsloopwebleacherextractinternetsnatchrecoverprogramdialcollectblockscourmp3accelerategetbotleecherget botrippumpsearchhttpfixboostsoftwarestripscheduledefeatftp
Blaze Media Pro

Shareware by Mystik Media
108 x 19435Kb downloads

Free Vista Files award
...two-way conversions among MPEG-1, MPEG-2, AVI, WMV, ASF, Flash (SWF and FLV), iPod, PSP, 3GP, and MOV...
 
burningconversioneditorcopiercompressionmpgvcdrecordermusicmpegoggeditingwmarippingvideoburneraudioconvertercompressorripperdvdmp3copycapturwmvsoundwav
Ainsoft DVD to FLV Converter

Shareware by AinSoft
8 x 16168Kb downloads

...good assistant for you to convert DVD to Flash Video format (FLV). It cannot only help you...
 
dvd flash videoconvert dvd flvdvd flv converter
...Flash Media Player is a handy flash tool kit designed as Macromedia flash player and...manager. It has several powerful flash tools: preview and browse flash movie, capture flash...image and set it as wallpaper, create flash screensaver with ease, make conversion between SWF and...EXE flash movies etc. All of these features will help...enhance and extend the using possibility of existing flash files.
 
flash screen saverflash kitmacromedia flash player
Flash Player Pro

Shareware by FlashPlayerPro.com
111 x 40694Kb downloads

...Flash Player Pro is a handy flash tool kit designed as Adobe flash player and...manager. It has several powerful flash tools: download flash movies, preview and browse flash movie, capture flash...image and set it as wallpaper, create flash screensaver with ease, make conversion between SWF and...EXE flash movies etc. All of these features will help...enhance and extend the using possibility of existing flash files.
 
flash screen saverswf playermacromedia flash player
AtPresent Recorder

Shareware by AtPresent Software
31 x 692Kb downloads

...and automatically make a project to build interactive Flash based simulation, presentation, demo, tutorial. Use it separately...
 
presentationcapturemovierecordingjavatrainingdesktopinteractionrecordercapturingsimulationtutorialscreenshotflashdemo
27 Tools-in-1 Wichio Browser

Shareware by Revopoint Co., Ltd.
18 x 6685Kb downloads

...by saying anything you want. Wichio features Screen Capture (multiple captures without pasting), Download Manager (for groups...
 
reminderflashtranslateprivatehistorye-mailresourcelyricnetstatdictionarycookiesscreenupdatespeechfillerrefreshtraceroutewhoismapdnsvoicecurrencycacheblockalertcaptureweather
Sothink SWF Decompiler-Flash Decompiler

Shareware by SourceTec Software
44 x 44447Kb downloads

...Sothink SWF Decompiler is a comprehensive solution for Flash fans to use as: SWF to HTML5 converter,...to FLEX converter, SWF elements extractor, and online Flash downloader. You can easily convert the whole SWF...replace image/ text/sound elements for SWF, and extract Flash resources like shape, image, sound (mp3 or wav),...frame, font, text, button, sprite, ActionScript, etc. This Flash decompiler supports Flash CS3/CS4/CS5/CS6 and ActionScript 2.0/3.
 
extract flashswf fla converterswf decompilerswf extractswf extractorconvert swf flaflash decompiler
AtPresent Recorder Pro

Shareware by AtPresent Software
24 x 11160Kb downloads

...from your computer screen and save it in Flash format in minutes! Set recording interval, record full...position, pointer type and clicks, edit and scale captured content, add mouse tracing and curve path, extra...record inside already captured screenshots sequence, define playing speed on the timeline,...burn your copyright, etc. Make well-compressed Flash movie that can be delivered over the Internet...
 
recorderinteractionflashtutorialjavacapturingdesktoppresentationmoviecapturerecordingtrainingscreenshotsimulationdemo
Demoshop

Shareware by Mandsoft
42 x 5586Kb downloads

...screen video to various formats such as Adobe Flash and AVI. Screen Video Codec: The Mandsoft Screen...MSCC is specially designed and optimized for screen capture so that the resulting files are small and...tutoring. Complex procedures can be shown quickly using captured program operation sequences. Record other video format (such...to promote your web site or other product. Capture an entire course for online and CD delivery...
 
screecamsoftwarescreen recordernanodemovideo capturescreen demoscreen capturefree
Flash to Video Batch Converter

Shareware by GeoVid
35 x 6573Kb downloads

...Convert Flash (*.swf) movies to video AVI/ASF/WMV/MPEG/VOB/MP4 files in a...batch. Flash To Video Bach Converter lets you easily transform...any Macromedia Flash (*.SWF and *.FLV files) to video movie file....Best choice for video editing software. You can capture Flash to Video including alpha channel (transparent video),...to advanced video editors such as Adobe Premiere. Flash To Video Bach Converter allows you convert any...
 
swf avibatch swf videoswf mpegflash video
...streams To download windows media streaming, realmedia streaming, flash video and other streaming, you need to know...* One-step solution to find the URLs * Capture RealMedia,Windows Media, flash streaming video and other streams...full URLs * Capture HTTP, MMS, RTSP streaming address * Download automatically...
 
capture urlcapture streamingurlsnooperfind urlurlhelperurl snooperurl helper
Hoo WinTail

Shareware by Hoo Technologies
30 x 1458Kb downloads

Free Vista Files award
...to load the entire file. Hoo WinTail could capture and display OutputDebugString (Windows debugging API) output as...log files, bookmarks support, minimize to systray and flash systray icon to indicate new lines written and...
 
windows taillog toolfile viewerlog viewerwintaillog utilityoutputdebugstringdebug toollog monitorhoo wintail
3D MP3 Sound Recorder

Shareware by TongSoft Inc.
21 x 1143Kb downloads

...etc. from your local computer or the internet. Captured sounds can be saved in WAV or MP3...
 
music capturewav recorderaudio recorderaudio grabbersound cardplaybackmoviessound recorder softwaremp3 encoderwavelive stream
Super Audio Grabber

Shareware by BlueSprite Inc
86 x 4923Kb downloads

...Super Audio Grabber is an easy and powerful audio grab software. You can make your own WAV/MP3/WMA files perfectly! 1) Record your own music, voice, other sound you...
 
audio format convertaudio capturewmarippermp3wavextract dvd
CodedColor PhotoStudio Pro

Shareware by 1STEIN Corp.
25 x 58000Kb downloads

...automatic white balance, skype photo sharing, CD/DVD burning, flash album export, new RAW formats, GPS tagging, 50...
 
acdseealbumexifimageconversionthumbsmultimediagraphicsbalancetifphotogpseditorpanoramaprintpublishbmpbatchpdfviewerdtpjpgorganizegifjpegflashrawcameraiptcarchivepicasawmfcatalog
DemoCharge

Shareware by YesSoftware, Inc.
26 x 7347Kb downloads

...by capturing your desktop. DemoCharge allows you to capture screen activity to create animated demos and content...animated demos in minutes: - Casual users can capture problems live and email them to support, -...
 
trainingdesktopdemorecordknowledge basesupportdocumentationsoftwarepresentationgifscreenanimatedtutorialcapturetestingdocuments
Free Vista Files award
...The Web browser is probably the most frequently used software today, and many tasks are highly repetitious. The iMacros software relieves the repetition of checking on the same sites every...
 
simulatetestingautocompletesilverlightautomaterecorderfirefoxwebagentuploadschedulerrobotcomponentform fillerscriptingperformancejavaautomationappletsflashinternetbatch