1 2 3 4 5 6 7 8 9

Sort by : ReleasedNameDownloadsAddedRatingRelevance
PDF417 Encoder Premium Package

Shareware by Barcodesoft
10 x 2441Kb downloads

...also a sample in the package. You will find how easy it is to integrate bar coded...
 
isoiec 154382006micropdf417isoiec 24728pdf 417 barcode
AimAtFile Fast File Search

Shareware by AimingTech Company
11 x 617Kb downloads

...AimAtFile is an effective way to find document files by their contents. It lets you...The content search functionality is based on Microsoft Indexing Service included in Windows 2000/XP/2003. AimAtFile provides a...without opening them in their editing programs. Microsoft Indexing Service scans files in the background as a...low-priority process and AimAtFile requests this index to return search results instantly. Unlike the most...
 
findnetworkfileindexingsearchofficeservicemicrosoftdocumentpdf
Archivarius 3000

Shareware by Likasoft
17 x 5486Kb downloads

Free Vista Files award
...accessible, Archivarius 3000 will later be able to find it by content and determine on which disk...special knowledge. The Search Wizard will help to find documents by size, date and type in just...function speeds up document overview highlighting query words, finding and printing the needed fragment, even if the...
 
full-textdocumentenginehtmlsearcharchiveindexoutlookpdf
...such as Google and others, allow you to find sites quickly and accurately. And, it was never...a lot of time browsing FTP servers to find updated documents or packages. FTPUpdateSearcher allows you to...FTP administrators do not bother to create file indexes and set up a file search via the...client. It is your personal FTP search and indexing engine. The program scans a given FTP server...and creates a searchable index of files.
 
scan ftpsearch updatesdownload ftpupdatesearcherftpupdatesearcher downloaddownload managersftp searchindex ftpsearch ftp serversdownload updatesfile sharingftp search engine
Personal Knowbase information manager

Shareware by Bitsmith Software
8 x 4534Kb downloads

Free Vista Files award
...keywords using Personal Knowbase. Capture, index, cross-reference, and find related information easily. This freeform information manager software...
 
notescardfileorganizeorganizerportableindex cardswritingsoftwareknowledgeknowbaseinformation
MediaSnooper

Shareware by BaseCraft Software
8 x 1961Kb downloads

...MediaSnooper is a personal system for indexing and searching for files in a local network....various information. And it’s sometimes very difficult to find something important in a large network. MediaSnooper can...case. The search is carried out by an index database, so the time of showing results reduces...to fractions of a second. Special features for finding mp3 files are supported. You can specify additional...
 
mp3 searchlocal network searchfile searchfile indexing
CardFile Pegasus

Shareware by PinderSoft
20 x 5190Kb downloads

...been listed, use the powerful search function to find it for you. Be it an exact match,...search and list all of the results it finds in the database. If your personal information is...
 
pimdata warehousingindex cardsrolodexprofessional organizerpersonal information managercardfilecard filepersonal databasedata storageaddress book
DbWeigher

Shareware by dbweigher.com
11 x 884Kb downloads

...databases. It is useful if you want to find the differences between the latest and previous database`s...Current version of the program allows you to find differences among tables, fields, indexes, relationships, procedures and...
 
columndifferencefieldshow differenceddlschemarelationshipdatabasecompareindexdbweigherdata definition languagesqltablevisually
...The Sleuthhound! Desktop Search brings search engine power to your PC and allows you to instantly search files, documents, email, anything. The Sleuthhound! searches Microsoft Word, Excel, and PowerPoint files,...
 
searchfiledesktopindexdocumentswindowstoolbarenginelostfind
Cookie Index.Dat Viewer

Freeware by TeoSoft
30 x 68Kb downloads

...allow you to review content of cookie folder, find its location and manage (delete) cookies manually by...
 
cookieindexdatviewcontent
Pic Catcher Express

Shareware by Oliver Ber_thold
14 x 900Kb downloads

...pics/galleries - new pics will be downloaded. Configurable index pages allows for comfortable picture view. Search, Find...
 
galleriesautomaticspiderfilterautomatischanonymbildershowsnifferpasswordpicindexweb scanner
History Killer Pro

Shareware by Emergency Soft
7 x 2821Kb downloads

...website information untouched. With custom search you can find all unuseful items related your search query. See...
 
cachehistory killer protemperaseblockeronlinecookiesfilesinternet securitytrackssecurely deletetracesremoverecent listsprivacy keeperregistry cleaninternet privacylogsindexdat
Audio-CD-Archiv v7

Shareware by GBelectronics GmbH
51 x 63453Kb downloads

...a password against unauthorized access. Use the sort index for Artists so that all names are sorted...of First name + Last name. Search and find very easy and quickly duplicate titles. You can...
 
musiccentermusic cdsaudio samplesort indexripperjukeboxrippenremote controllyricsarchivcdarchivcatalogingipodgbelectronicsduplicate titleslosslescovercd-archivmp3encodenencoderiphone
Complete Cleanup

Shareware by SoftDD Software
18 x 930Kb downloads

Free Vista Files award
...objects. This also allows you to scan and find all duplicate files, and performs many other disk...
 
cleanerwebfiledeletewipeinternetcachedrivemozillacookieregistrycookiessoftwaresecuritywindowsexplorerdiskwasherremovecleanuphistorycookie cleanerprivacycookie cleanupremover
EZQuote

Shareware by EZTradingClub
22 x 16353Kb downloads

Free Vista Files award
...in total. This is a great tool to find and select the securities you are looking for....as A/D Line, A/D Ratio, McClellan Oscillator, Arm Index and many others. The latest version includes new...features such as security search, index calculator and ability to load customized symbol lists...
 
quotesstockmarketdownloader
Find It Pro - Enterprise

Shareware by Skylark Utilities
16 x 1011Kb downloads

Free Vista Files award
...utility with a rich set of features including index database support. Searching criteria includes files/folders with include/exclude...make it more productive and easier to use. Find It Pro also includes the Find It Indexer...which is use to build a precise keyword index database for your files. The indexer will produce...way you search. You can then load the index database into Find It Pro and conduct your...searches in record time.
 
find proindexingfind-it-prokeywordsfilesdrivessearchfolderslogicindexer
SuperCleaner

Shareware by South Bay Software
22 x 465Kb downloads

...one disk cleaner for Windows. Its built-in Garbage Finder can find hundreds or even thousands of megabytes...to manage them. The Start menu cleaner can find items in your Start menu which are dead...
 
cleanercookiesprivacytempfilesdiskspacefile wipinghistory
Prime Privacy Protector

Shareware by Prime Software
3 x 5117Kb downloads

...With one simple click, Prime Privacy Protector can: » Clear your browser history - Internet Explorer, Netscape, FireFox, Opera, Google Chrome » Erase your browser cache » Eliminate all your system cookies » Remove your...
 
protect your privacyinternet history erasererase registery trackshard drive cleansystem cleanuperase computer tracksevidence removalerasing internet trackseliminate evidenceprivacy protection software
Evidence-Blaster

Demo by WCCL
21 x 2177Kb downloads

Free Vista Files award
...Evidence-Blaster completely cleans your history, ensuring your computer and Internet use cannot be discovered by anyone EVER. Protect Identity Theft TODAY! Evidence-Blaster can automatically clear your browser history,...
 
erase porn from computerevidence-blasterinternet washersecurity softwareevidence eliminatordelete historyinternet eraserevidenceeliminatorevidence blasterclear historywindows washerclean computerevidence-eliminatorprivacy softwareclean hard
Domain Name Pro

Shareware by Backslash
14 x 9102Kb downloads

Free Vista Files award
...web site competition rating and domain name effectiveness index (TM) for generated domain names, identifying expired and...
 
toolgenerateweblistlinkfinddomainsearchinternetutilitytrademarkurlwhoisaddresspopularityemail