1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
The Clickbank Code News Reader

Freeware by Clickbank Code
8 x 1164Kb downloads

...on THE CLICKBANK CODE : How A Clickbank Experiment Revealed A Secret Formula For Affiliate Marketing. The...39 Year Old Clickbank Affiliate Utilises Scientific Clickbank Experiments And Raked In $48K In His First 4...
 
the codethe clickbank code
Advanced Pathway Painter

Freeware by GSA
30 x 5145Kb downloads

Free Vista Files award
...kind of quantitative data from gene and protein experiments directly within the pathways (colours represent the value)....The linking between the pathway items and the experiment data is done over the gene or protein...
 
genmappbioinformaticsncbibiocartamicroarrayproteinbiologykegggeneanalysispathwayaffymetrixexperimentsequenceanalyseannotationbioscience
ColorSwap

Shareware by plexityHide.com
20 x 5288Kb downloads

...Change color on your hair? Now you can experiment safely on your PC. Object isolation in bitmap-images...controlled individually, you now have complete freedom to experiment with any color on the object and see...
 
re-coloringhsvdifferent colorswap colorpaint jobrgbrepaintvirtual paintchange colorobject isolation
Physics Virtual Laboratory, PVL

Shareware by Virtual Dynamics Org
14 x 3613Kb downloads

...classes (3) at home by students to run experiments with the student`s data, even extreme experiments, which...(traditional) Physics laboratory it is impossible to execute experiments with extreme parameters, for instance it is impossible...gravity, it is not possible to carry out experiments in "Slow Motion" or to settle a "time...vectors (forces, velocities, etc) -Slow Motion: executes an experiment sslowly enough for the user to appreciate the...
 
simulationexperimentsmathematical modellinglearningteachingvirtual laboratorieseducationvisualizationphysics
Oscillations

Shareware by Virtual Dynamics Org
10 x 1171Kb downloads

...classes (3) at home by students to run experiments with the student`s data, even extreme experiments, which...Oscillations makes the students really learn because the experiments exceed those studied in a traditional Waves &...(traditional) Physics laboratory it is impossible to execute experiments with extreme parameters, for instance it is impossible...gravity, it is not possible to carry out experiments in "Slow Motion" or to settle a "time...
 
harmonic motionsimulatorswavescollegeteachingpendulumshmperiodamplitudeoscillationsenergyuniversityexperimentsphysicsfrequencylearningeducationhigh school
Electromagnetics

Shareware by Virtual Dynamics Org
13 x 1171Kb downloads

...classes (3) at home by students to run experiments with the student`s data, even extreme experiments, which...Electromagnetics makes the students really learn because the experiments exceed those studied in a traditional Electricity and...(traditional) Physics laboratory it is impossible to execute experiments with extreme parameters, for instance it is impossible...gravity, it is not possible to carry out experiments in "Slow Motion" or to settle a "time...
 
experimentselectricitymagnetismohmlearninguniversitydielectriccollegepotentialpotentiometerresistancewheatstoneteachingelectronelectromotivehigh schoolcoulombeducationphysicselectric circuitssimulators
Loan Repayment Grid

Freeware by Property Rentals
13 x 1889Kb downloads

...Calculate your home loan repayment and experiment with different options to reduce your total payment...
 
loan repaymentloan calculatorhome loan
SLang

Freeware by Ian Pegler
22 x 1140Kb downloads

...specify dependency-relationships between events, SLang allows you to experiment with which events get included in the story...
 
story writingstory development
Mechanics

Shareware by Virtual Dynamics Org
14 x 1855Kb downloads

...classes (3) at home by students to run experiments with the student`s data, even extreme experiments, which...Mechanics makes the students really learn because the experiments exceed those studied in a traditional Mechanics course,...(traditional) Physics laboratory it is impossible to execute experiments with extreme parameters, for instance it is impossible...gravity, it is not possible to carry out experiments in "Slow Motion" or to settle a "time...
 
rectilinearaccelerationphysicsequilibriumuniversityvelocitymechanicspendulumlearningparabolicenergyteachingvectorcollegeforcefrictionexperimentsmotionmomentumeducationnewtonhigh schoolsimulators
Grav-T demo

Demo by Gregory Defaisse
5 x 61523Kb downloads

...moto trials simulation for windows PC. A unique experiment witch will let your ability and mastery expresses...
 
onlinesimulationmotorcyclegamestrialsfun
Starcars

Shareware by Peachysoft
24 x 1807Kb downloads

...Help an Intersellar Pilot return home after an experiment lauched him all the way to the other...
 
starcarsskyroadsplatform game

Freeware by Code-Guy.com
13 x 1118Kb downloads

...that the program will drop over the pattern. Experiment with it and you may achieve interesting results....
 
graphicsphotoshopprocessingimageeffecteditor
Two Channels Frequency Generator

Freeware by Cognaxon
37 x 482Kb downloads

...Two Channels Frequency Generator. Version 1.0. The program allows independent control of frequency, phase and volume on left and right channels. Measured data points can be easily captured to...
 
experimentlaboratoryfreepsychophysicspsycho-acousticseducational
Run BASIC Free Edition

Freeware by Shoptalk Systems
88 x 11072Kb downloads

...example programs included. This free edition lets you experiment with the Run BASIC system on a single...
 
businessprogramminglinuxosxwindowslearnappserverbasicdevelopmenteducationweb
Photo Makeup Editor

Shareware by AMS Software
30 x 3266Kb downloads

...your eyes. Photo Makeup Editor allows you to experiment with your appearance - change the color of...wild and try everything! If you like to experiment with your appearance or just need to be...
 
enhance photosretouch portraiteye shadow makeupphoto makeupvirtual makeover
Magic Matching Color

Shareware by Magic Project
10 x 269Kb downloads

...colors from any given color. It`s easy to experiment with colors, see the changes if only one...
 
picksoftwarecombinationcolorcolourswebcombinerpaletepalettepalleteweb sitematchprogramcreatingmatchingsharewarepickerright colorspagemixingscheme
Virus : Alter Life 2

Shareware by TameStorm Games
34 x 5615Kb downloads

...After unsuccessful experiment of the military AI control has been lost....
 
virusesrts gamealter lifestrategy game
...This is a screen saver for Windows. It generates a static image of a fractal. You can configure the displayed image click Configure button. You can zoom in parts of...
 
juliascreensaverfractalfreeware
Corel AfterShot Pro

Shareware by Corel Corporation
2 x 34022Kb downloads

...search by camera settings, keywords, tags and more. Experiment with and alter images freely with non-destructive adjustment...
 
aftershot procorelphoto edit
HotShot

Demo by Cybia
26 x 554Kb downloads

...the RGB values, flood with intense colour casts. Experiment with the slider combinations and see the possibilities...
 
enhancementpspcolorpaintshop propluginsfiltercybiaimagephotoshopcolourplug-insfilters