1 2 3 4 5 6 7 8

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
92 x 126464Kb downloads

Free Vista Files award
...e-mail encapsulated in S/MIME is available. This Microsoft Exchange alternative is optimal for a small-to-medium size organization...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Pivo DnsResolver Component

Freeware by Pivo Corporation
43 x 232Kb downloads

...for each host name, and lists the mail exchange servers accepting e-mail for each domain. The DNS...network hardware work with IP addresses to perform tasks such as addressing and routing, humans generally find...
 
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
IDEA! Free Edition

Freeware by SYCON Beratungs GmbH
39 x 5279Kb downloads

...allows you to utilize the tool for small tasks at home as well as for large projects....parts or whole knowledge bases, reporting, easy data exchange between the single user and team edition, fast...
 
information managerbusiness organizerorganizationknowledge managementknowledge organizerbusiness toolsdocument managementcollaboration tooloffice toolsdatabasesproject management
Easy2Sync for Outlook

Freeware by ITSTH
48 x 9250Kb downloads

...any new or changed e-mails, calendar items, contact, tasks or notes to the other computers to make...works with normal PST files as well as Exchange server accounts. You can either synchronize your data...
 
netzwerkmicrosoft outlooknotebooknetzwerktoolslaptoplansynchronize outlooksynchronize pstsync outlook
newObjects ActiveX Pack1 family

Freeware by newObjects
30 x 2590Kb downloads

...levels with different tools for wide variety of tasks thus minimizing the porting efforts and providing the...
 
sqlshortcutdatabasecomponentstoragejscriptfilethreadvbscriptcollectionlibraryrecordcryptographybinaryflataspstream
ManageEngine ADManager Plus

Shareware by ZOHO Corp.
34 x 36864Kb downloads

...bulk-creation of AD objects with all properties including Exchange attributes in just a few clicks, or by...This product supports even the latest version – Exchange 2010. The comprehensive and comprehendible reports present consolidated...flexible enough to allow a helpdesk technician perform tasks flawlessly, yet, rigid enough not to elevate the...with AD Automation – to automate major AD tasks and their time-based follow-up tasks, AD request...
 
active directory workflowpassword managementactive directory automationsecurity delegationreport active directory usersexchange managementwindows network managementlogon reportsbulk user management
GroupWare

Demo by Alt-N Technologies, Ltd.
10 x 1946Kb downloads

...without the expense or expertise required by Microsoft Exchange Server. Features include user configurable permissions where GroupWare...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
Acronis True Image Enterprise Server

Demo by Acronis
14 x 188974Kb downloads

Free Vista Files award
...— Online backup of databases, such as MS Exchange Server, MS SQL Server and Oracle 64 bit...
 
online data backupswindows server 2000 backupremote online backupbackup mail enterprise serverexchange server 2003 backup
Free Vista Files award
...network solutions without or in connection with an Exchange Server. OLfolders allows the access and sharing of...OLfolders can co-exist perfectly in an existing MS Exchange environment, for example to create additional shared folders...project and without loosing the connection to Microsofts Exchange Server. For offline access, data can be replicated...
 
exchangeshared contactsoutlook 64bitoutlook pstshared foldersoffice networkingoutlook 2010outlook pluginoutlook networkoutlook add-inoutlook groupwareoutlook 32bitpersonal foldersoutlook sharingoutlook add-on
Free Vista Files award
...64-bit) add-in without or additionally to a Microsoft Exchange or OLfolders Server. QSynchronization, the synchronization program for...
 
sync tooloutlook synchronizationoutlook add-onnotebook syncoutlook notebookshared foldersoutlook 2010outlook 32-bitshared contactsoutlook 64-bitshared outlookoutlook synchronizershared emailsoutlook sharing
QSearchFolders

Shareware by Quester
13 x 1017Kb downloads

...also with any personal folders files in an Exchange Server 2000 & 2003 environment and with OLfolders...
 
share foldersoutlook shared filespersonal folderssharing pstoutlook folder managementshare outlookoutlook teamoutlook groupwareoutlook sharingoutlook search folderoutllook folder listsearch folders

Shareware by NetPromoter
19 x 38988Kb downloads

...So why not solve all Web site promotion tasks with a few clicks of a mouse? NetPromoter...
 
site optimizationbroken links checkurl registrationsite promotionlink exchangeseo optimizationdomain name checkinglog analyzersearch engine submissionsite submissionsite statisticsmeta tag editing
MAPILab Share`n`Sync

Shareware by MAPILab Ltd.
12 x 3009Kb downloads

Free Vista Files award
...MAPILab Share`n`Sync is designed to solve two tasks - synchronizing Outlook folders on several computers and...transports. The product is fully compatible with Microsoft Exchange Server and Microsoft Small Business Server. So if...want to synchronize a shared folder on Microsoft Exchange Server with an ordinary folder on your home...PC... No problem! Actually, computers exchange data by e-mail. Before the data is transmitted,...
 
sync pstmicrosoft outlookoutlook add-inoutlook shared accessoutlook synchronizationpublic folders
Infinity

Shareware by MathRevolt
12 x 2002Kb downloads

...are many things that require mathematical modeling: from exchange rates prediction to engineering and financial planning. That...that is flexible enough to handle solving various tasks that may be described using formulas and equations....among math applications perfectly suited for serious scientific tasks and business calculations altogether. So, why waste time?...
 
systemsordinarydifferential equationsmathnon-linear
Recovery for Exchange Server

Demo by Recoveronix Ltd.
9 x 5062Kb downloads

...Recovery for Exchange Server is a data recovery program for Microsoft...Exchange Server databases. Recovery for Exchange Server processes corrupted mail databases (.edb, .stm) and...Outlook or other compatible mail client. Recovery for Exchange Server supports Exchange 2010, 2007, 2003, 2003 SP1,...
 
corrupted exchange serverrecover exchange serverrecover edbedb pstedb repair toolexchangeserverrecoveryrepair edbrecover mailbox from edbedb pst converterrepair exchange databaseextract pst from edbrecover offiline edb
Recovery for Exchange

Demo by Recoveronix Ltd.
7 x 1617Kb downloads

...Recovery for Exchange is a data recovery program for Microsoft Exchange...(.ost) remain on client computer, holding emails, contacts, tasks and other items from the original mail account....Recovery for Exchange converts these files to more common Personal Storage...with Outlook or other compatible mail client. Supports Exchange 95/98/2000/2003/2007. Recovers folders, messages (including those with file...
 
ost corruptedrepair offlineost2pstrecovery orphanedrepair ostfix ostrecover ostrecovery offlinecorrupted ostrecovery ostost recoveryoffline recoveryexchangerecoveryoffline repairorphaned recovery
Free Vista Files award
...and customer information, stored in your database. -Create Tasks in Outlook based on events in your database....-Public folders support GeniusConnect will synchronize Outlook or Exchange data with any relational database that supports ODBC...possible to use GeniusConnect on multiple Outlook or Exchange folders and multiple databases. Supports synchronization of the...
 
odbcnoteinterbasecontactmsdepostgresqljournalbackupinformixoutlooksqlbasecrmmysqlwatcomoracleadabascalendardbasetasksql serverexchangeparadoxdatabasesynchronizemailaccessfoxproibm db2sybase
USA Real Estate Map Pro

Shareware by USFlashMap.com
7 x 10669Kb downloads

...locations. The map can also perform any other tasks that require withdrawal of information when you click...The system architecture and the protocol of data exchange between the map and a database allow creating...
 
flash mapusa real estate mapsinteractive real estate map
MSD Organizer

Shareware by MSD Soft
17 x 4021Kb downloads

Free Vista Files award
...Data Import/Export, provided by tools that allow the exchange of information with other programs. · Complete reports,...
 
personal information managerpropertydiarycontactsbudgetplanneralarmsmusicagendapimhealthorganizercalendartasksphonebook
MSD Organizer Multiuser

Shareware by MSD Soft
13 x 5721Kb downloads

Free Vista Files award
...Data Import/Export, provided by tools that allow the exchange of information with other programs. · Complete reports,...
 
agendaphonebookcalendarhealthmusiccontactsorganizerbudgetpropertynetwork pimpersonal information manageralarmsplannertasksdiary