1 2 3 4 5 6 7 8 9 ... 52 53 54 55 56 57 58 59 60 61

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
295 x 11118Kb downloads

...all network releases, also all background connections of exchange programms like Kazaa or Emule, Netmeetings and chatsystems...of connections over a number of individual WHOIS servers including the X500 NASA server.The HTTP module offers...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...integration with existing directory services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for...e-mail encapsulated in S/MIME is available. This Microsoft Exchange alternative is optimal for a small-to-medium size organization...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...set up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...application monitoring. Applications Manager proactively monitors applications and servers and notifies problems in network through e-mail/SMS. It...higher availability and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss...Oracle, SQL Server, Sybase, PostgreSQL, memcached and DB2. Server Monitoring involves monitoring of Windows, Linux, HP-Unix, Tru64...monitoring.
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows combining...avoiding the backscatter problem caused by some mail servers trying to send non-delivery notifcations to forged sender...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
YourForex Trader

Freeware by Your Forex LTD
73 x 7008Kb downloads

...YourForex Trader represents a revolutionary currency (FOREX) trading platform. 24-hr trading, Free Demo and Charting, News, commission free trading, Narrow Spreads, Consistent Liquidity, 100:1 leverage, professional service and...
 
foreign exchangecommodities and futuresinvestmentcurrency exchange ratefinanceforex brokerbrokeragescurrency tradinginvestingonline forex trading
ManageEngine OpManager

Freeeware by AdventNet Inc
131 x 39569Kb downloads

...Are you using multiple tools for your network management needs? Put a stop to the daily searches, downloads and confusing reports that come along with disparate management tools! OpManager is...
 
network monitoring toolnetwork management softwareserver management software
T42

Freeware by Klever Group
95 x 214Kb downloads

...our PumpKIN TFTP client/server software which lets you exchange files with your party while having a talk...
 
text chatntalk
Pivo DnsResolver Component

Freeware by Pivo Corporation
56 x 232Kb downloads

...Dns Resolver is used to queries DNS servers for host information and programmatically query DNS servers...for each host name, and lists the mail exchange servers accepting e-mail for each domain. The DNS provides...
 
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
Salaat Time

Freeware by Salaat Time
141 x 14351Kb downloads

Free Vista Files award
...available. Optional adjustment of calculated times. •Dynamic Data Exchange Server support. DDE Interface...
 
prayer timesmuslimathanhijri calendarathansislamprayer softwareazansqiblah direction
...video search toolbars • Stock quotes and currency exchange toolbars Version 2.0 introduces the revolutionary feature of...submenus can be created from the output of server side scripts (like PHP, Perl CGI or ASP)...
 
softwarebuildgoogleietoolbarsharewarealexadeskbargeneratedesignerdynamicexploreriebarfreewareconstructorconfigurecreateautoadwarewizardcompile
Nelson Email Organizer - NEO Free

Freeware by Caelo Software Inc.
56 x 12054Kb downloads

...Free works with a single Personal Folder or Exchange mailbox using all versions of Outlook (except Outlook...
 
add-onsearchingbulk mailcommunicationsproductivityexchangeorganizationspamplug-inbusinesse-mailemailorganizerindexersimplefreepluginaddonautomaticoutlookadd-invirtualaddin
...Email Templates is an extension to Microsoft Outlook designed to send personalized messages rapidly to individuals and multiple recipients. Email Templates has the ability to create customizable message templates, speeding...
 
outlook 2000emailadd-insaddinssharewaremicrosoft outlookutilitiese-mailwindows messagingexchange serveroutlook 2002
Easy2Sync for Outlook

Freeware by ITSTH
53 x 9250Kb downloads

...works with normal PST files as well as Exchange server accounts. You can either synchronize your data or...
 
sync outlooknetzwerknetzwerktoolsmicrosoft outlooklannotebooksynchronize outlooksynchronize pstlaptop
SpreadMsg Lite

Freeware by Compuquest, Inc.
22 x 664Kb downloads

Free Vista Files award
...the user`s email waiting at their ISP or Exchange Server. EMail scanning and retrieval is supported for...
 
2-waytradingblackberrystormpcsinstant messagingmessagestockt900weathermonitorgsmpower lossalertinfo-on-demandx10filternetworkblackoutsmswirelessfuturestemperaturealphawarningemailcellularopen viewpager
SecExMail SOHO

Freeware by Bytefusion Ltd.
17 x 2667Kb downloads

Free Vista Files award
...SSL secure socket layer library.Now includes automatic key exchange and powerful html filtering to protect from malicious...
 
secure emaile-mail encryptionsecure e-mailfree email encryption
Free Vista Files award
...over the Internet: You could deploy StoreGrid Backup Server in your own data center / co-lo and...over the Internet to a remote StoreGrid Backup Server Cluster. In this case, the StoreGrid Backup Server...to Remote location: In case the local backup server is required at the customer premises, StoreGrid can...be deployed as a local on-site backup server with client machines backing up to a locally...
 
remote backup softwareexchange backup softwareoffsite backup softwaresql backup softwareonline backup software
...File Access Manager, is a robust open file utility that gives your backup software the power to backup any open, locked or in-use file, ensuring that your business will...
 
unlockedoutlookaccessopenedntusersqlexclusively lockedbackup lockedexchangein-usewordopen file backupntuserdatbakkupclosedbakupbacupinuse
OST to PST File Converter

Shareware by OST to PST
54 x 11264Kb downloads

...OST file error issues such as virus attack, server crash, accidental user account deletion, MS server downtime,...converter also supports Windows 8.1 OS and MS Exchange Server 2013. Download OST to PST tria version to...
 
download ost pstost pst converterconvert ost into pstost pst fileost pst toolost pst conversionost pst file converter
Visendo Mail Checker Server 2006

Shareware by ppedv AG
26 x 10791Kb downloads

...With Visendo Mail Checker Server 2006 we present an e-mail solution for protecting...based on the very successful tool Mail Checker Server 1.3. SPAM detection and destruction is one of...the new main features. Mail Checker Server is located between the internet and your in-house...run it without any security concerns on your Exchange Server. The mail traffic is filtered by different...certain spam.
 
emailserver integrationanti spamvirusexchangeserver based