Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
292 x 11118Kb downloads

...all network releases, also all background connections of exchange programms like Kazaa or Emule, Netmeetings and chatsystems...
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
119 x 126464Kb downloads

Free Vista Files award
...LDAP over SSL (LDAPS). Support for standard public key encryption and signing of e-mail encapsulated in S/ available. This Microsoft Exchange alternative is optimal for a small-to-medium size organization...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...Project Planner Reader (PPR) files to MS Project Exchange format(MPX), which can be viewed using MS Project...
project plannermicrosoft projectms-projectsmartworksmpxmpp2pprfree
Mach5 PopMonger Regular

Freeware by Mach5 Development
73 x 2782Kb downloads

Free Vista Files award
...set up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background....
ManageEngine Applications Manager

Freeware by ZOHO Corp.
105 x 49152Kb downloads

...of the following services : JMX applications, Microsoft Exchange Server, Service Monitoring (any TCP/IP port),SNMP Agent,Web Server...
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...NoSpamToday is a e-mail spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows combining the award-winning SpamAssassin filter, an attachment...
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
DXF Import/Export Converter

Freeware by S&G Team
153 x 10223Kb downloads

...ability to read and write AutoDesk`s DXF (Drawing Exchange Format) vector-based files. AutoCAD DXF is an open...industry standard for the exchange of CAD drawings. DXF Converter allows to import...
YourForex Trader

Freeware by Your Forex LTD
73 x 7008Kb downloads

...YourForex Trader represents a revolutionary currency (FOREX) trading platform. 24-hr trading, Free Demo and Charting, News, commission free trading, Narrow Spreads, Consistent Liquidity, 100:1 leverage, professional service and...
foreign exchangecommodities and futuresinvestmentcurrency exchange ratefinanceforex brokerbrokeragescurrency tradinginvestingonline forex trading
ManageEngine OpManager

Freeeware by AdventNet Inc
129 x 39569Kb downloads

...Are you using multiple tools for your network management needs? Put a stop to the daily searches, downloads and confusing reports that come along with disparate management tools! OpManager is...
network monitoring toolnetwork management softwareserver management software
DipTrace Free

Freeware by Novarm, Ltd.
95 x 95857Kb downloads

...thermals or shapes). DipTrace modules allow you to exchange schematics, layouts and libraries with other EDA and...
pcb softwareelectronicsschematic captureecadpcb layoutpcb design software
Shark Email Extractor

Freeware by
249 x 440Kb downloads

...Shark Email Extractor is designed to search chosen files for email addresses and it automatically extract all e-mail addresses from those file(s).You can search your entire system...
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber
Simple Currency Converter

Freeware by OnlineFinancialSite
82 x 343Kb downloads

...calculator instantly converts base world currencies and updates exchange rates with a single button click. Cross currency...
dollarforexeurocurrencyfreepoundmarkcalculatorforeign exchangecheckconverterratestravelerfrankyencurrencies

Freeware by Klever Group
95 x 214Kb downloads

...our PumpKIN TFTP client/server software which lets you exchange files with your party while having a talk...
text chatntalk
Ares Galaxy PRO

Freeware by Ares Galaxy Online
419 x 14027Kb downloads

...Ares Galaxy Professional Edition is currently one of the most demanded BitTorrent file sharing clients around. Most users prefer it thanks to its simplicity, effectiveness, its attractive, easy to use...
file sharing programsfile sharing applicationp2p softwarep2p clientbittorrent clientp2p programdownloadsfilesares galaxy pro editionpeer-to-peer application
Pivo DnsResolver Component

Freeware by Pivo Corporation
56 x 232Kb downloads

...for each host name, and lists the mail exchange servers accepting e-mail for each domain. The DNS...
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
Euro Converter

Freeware by Camtech 2000
16 x 1403Kb downloads

...vice versa. It works by getting the current exchange rates from the Internet so the rates are...
Salaat Time

Freeware by Salaat Time
137 x 14351Kb downloads

Free Vista Files award
...available. Optional adjustment of calculated times. •Dynamic Data Exchange Server support. DDE Interface...
prayer timesmuslimathanhijri calendarathansislamprayer softwareazansqiblah direction
SkyFex Remote Desktop

Freeware by Tomsk, Inc.
87 x 2016Kb downloads

Free Vista Files award, - Concurrent remote user logins, - Remote key combinations support, - Updates upon browser start, -...
remote destopdesktop streamingremote accesshelp desk softwareremote assistancedesktop sharingremote supportonline collaborationremote desktop controlremote solutionremote support softwareremote control

Freeware by TJ Enterprises LLC
67 x 23068Kb downloads

...QuidProQuo automatically scans through your site to locate your link partners. It then spiders through your link partners sites to verify reciprocal links back to you. It will find the...
quidproquoverificationreciprocal link checkerreciprocal linkinglink exchange softwarecheckingconfirmation

Freeware by Browse3D Corporation
34 x 2188Kb downloads

...of your research containing multiple web pages, and exchange these rooms with colleagues or friends. Browse3D, the...
internet browserweb browserbrowse3dsave rooms information