1 2 3 4 5 6 7 8 9 ... 44 45 46 47 48 49 50 51 52 53

Sort by : ReleasedNameDownloadsAddedRatingRelevance
CiDess

Freeware by CiDess
96 x 3158Kb downloads

...publish your PCB - Support both French and English language, ability to change language during program execution...
 
layouteditorpcbfree
Polyglot 3000

Freeware by Likasoft
91 x 2717Kb downloads

...Polyglot 3000 is automatic language identifier that can detect the language used in...icons in menu and toolbar. Quick and correct language identification. Recognize language just among popular languages. Multilingual...
 
automaticidentifierrecognizerguesserlanguage
CatsCradle

Shareware by Stormdance
67 x 1379Kb downloads

Free Vista Files award
...HTML code. CatsCradle is written for professional freelance language translators and translation agencies - a dedicated web...very easy to translate web pages from one language into another. CatsCradle grabs all the text that...Features Include: - A multilingual GUI in 13 languages (Afrikaans, Brazilian Portuguese, Dutch, French, German, English, Hungarian,...
 
localisingwebtranslatortranslatingcatscradletranslationlocalizationlocalisationlocalizingweb pageweb page editorhtml
SecureCentral PatchQuest Free Edition

Freeware by AdventNet Inc.
86 x 30666Kb downloads

...simplified patch management. It supports patches in the English language for operating systems and applications like Windows Vista,...
 
linux patch managementmicrosoft security patchesmicrosoft patch managementpatch management softwarewindows patch managementsecurity patch managementhotfix management
...suit customer / event specific mini catalogs, catalog languages to build catalog in non english language etc....
 
catalog makermarketing softwarepowerpoint albumdigital catalogcatalogingalbum makercatalog softwarecatalog builderpresentation maker
Travel Dictionary English PPC

Freeware by TT- Software
85 x 5743Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For PocketPC2003 & Mobile Edition! Also available...
 
potuguesewindowscewincefreeitalianspanishgermanpocketpc2003frenchenglishdutchdictionarymobile edition
Travel Dictionary English HPC

Demo by TT- Software
67 x 8461Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For HPC till PPC2002 only! Also available...
 
dutchspanishenglishdictionarypotugueseitalianfreewincefrenchgermanwindowsce
Travel Dictionary Swedish PC

Freeware by TT- Software
63 x 7576Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! Also available for WindowsCE, PocketPC, Mobile Edition,...
 
englishspanishfrenchgermanwindowsfreepotuguesedutchdictionaryitalian
Travel Dictionary French PC

Freeware by TT- Software
29 x 12807Kb downloads

Free Vista Files award
...our "Goldversion" with over 600.000 entries from one language combination! Also available for WindowsCE, PocketPC, Mobile Edition,...
 
spanishitaliandictionarypotuguesefrenchwindowsdutchgermanenglishfreevista

Freeware by BLITZ-ART
72 x 533Kb downloads

...features: User-friendly, clear and intuitive user interface Three language versions (English, German and Polish) Picking any color...
 
color pickerfreewarecolsel
Travel Dictionary Swedish PPC

Demo by TT- Software
59 x 4767Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For PocketPC2003 and MobileEdition. Also available for...
 
englishdutchgermanwincedictionarypotuguesefrenchitalianfreemobile editionspanishpocketpc2003windowsce
Travel Dictionary Spanish PPC

Demo by TT- Software
53 x 5491Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For PocketPC2003 and MobileEdition. Also available for...
 
germanpocketpc2003potuguesedictionaryfrenchspanishdutchwincefreeitalianwindowsceenglishmobile edition
Travel Dictionary Portuguese PPC

Demo by TT- Software
62 x 5068Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For PocketPC2003 and MobileEdition. Also available for...
 
freepocketpc2003frenchspanishgermanmobile editionwindowscedutchwinceitalianenglishdictionarypotuguese
Travel Dictionary French PPC

Demo by TT- Software
53 x 5491Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For PocketPC2003 and MobileEdition. Also available for...
 
pocketpc2003dictionarypotuguesemobile editionfrenchdutchwindowscefreespanishgermanitalianenglishwince
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
114 x 29442Kb downloads

...TheSage`s English Dictionary and Thesaurus is a one-click complete dictionary...and multifaceted thesaurus of the English language. TheSage can look up words directly from...
 
speechword listspronunciationdictionarylookupthesageone-clickthesauruswildcard searchconcordancerenglishanagram
Travel Dictionary Swedish HPC

Demo by TT- Software
48 x 7485Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For HPC till PocketPC2002 only! Also available...
 
wincegermandutchspanishwindowscepotugueseitalianfrenchfreedictionaryenglish
Travel Dictionary Spanish HPC

Demo by TT- Software
60 x 8209Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For HPC till PocketPC2002 only! Also available...
 
wincefrenchdictionarywindowscefreedutchgermanenglishpotuguesespanishitalian
Travel Dictionary Portuguese HPC

Demo by TT- Software
59 x 7787Kb downloads

...our "Goldversion" with over 600.000 entries from one language combination! For HPC till PocketPC2002 only! Also available...
 
freeenglishdutchwindowscedictionaryspanishitaliangermanfrenchwincepotuguese
EditPad Lite

Freeware by Just Great Software
16 x 9258Kb downloads

...and Mac files. Create text files in any language you like, whether that`s English, French, Russian or...translated into many languages, including all documentation. Other language versions can be downloaded from www.editpadlite.com You can...
 
htmlwriterswordeditorswordpadeditingconvertwritingprocessingnotepadwebprocessorstext editor
Salaat Time

Freeware by Salaat Time
141 x 14351Kb downloads

Free Vista Files award
...from Arabic, English, French or by loading a language file. •All prayer time calculation methods available. Optional...
 
prayer timesmuslimathanhijri calendarathansislamprayer softwareazansqiblah direction