1 2 3 4 5 6 7 8 9 ... 37 38 39 40 41 42 43 44 45 46

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Free Bible Study - Add Any Texts

Freeware by BibleOcean.com
90 x 5859Kb downloads

...user experience. No previous Bible software experience needed. English and Spanish Bibles included....
 
greekjesuschristianconcordancelexiconnivwordwindowschurchhebrewmarkbiblematthewlukedictionarygodjohn
Travel Dictionary English PPC

Freeware by TT- Software
84 x 5743Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
potuguesewindowscewincefreeitalianspanishgermanpocketpc2003frenchenglishdutchdictionarymobile edition
Travel Dictionary English HPC

Demo by TT- Software
66 x 8461Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
dutchspanishenglishdictionarypotugueseitalianfreewincefrenchgermanwindowsce
Travel Dictionary Swedish PC

Freeware by TT- Software
62 x 7576Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
englishspanishfrenchgermanwindowsfreepotuguesedutchdictionaryitalian
Travel Dictionary French PC

Freeware by TT- Software
28 x 12807Kb downloads

Free Vista Files award
...data can be viewed separately in the user dictionary or together with the original data in the...
 
spanishitaliandictionarypotuguesefrenchwindowsdutchgermanenglishfreevista
Travel Dictionary Swedish PPC

Demo by TT- Software
58 x 4767Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
englishdutchgermanwincedictionarypotuguesefrenchitalianfreemobile editionspanishpocketpc2003windowsce
Travel Dictionary Spanish PPC

Demo by TT- Software
52 x 5491Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
germanpocketpc2003potuguesedictionaryfrenchspanishdutchwincefreeitalianwindowsceenglishmobile edition
Travel Dictionary Portuguese PPC

Demo by TT- Software
61 x 5068Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
freepocketpc2003frenchspanishgermanmobile editionwindowscedutchwinceitalianenglishdictionarypotuguese
Travel Dictionary French PPC

Demo by TT- Software
52 x 5491Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
pocketpc2003dictionarypotuguesemobile editionfrenchdutchwindowscefreespanishgermanitalianenglishwince
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
113 x 29442Kb downloads

...TheSage`s English Dictionary and Thesaurus is a one-click complete dictionary and...multifaceted thesaurus of the English language. TheSage can look up words directly from...and does not use your Internet connection. The Dictionary comprises: +210,000 multiple detailed definitions, +50,000 examples of...
 
speechword listspronunciationdictionarylookupthesageone-clickthesauruswildcard searchconcordancerenglishanagram
LingvoSoft Free Talking Dictionary English <-> Portuguese for Pocket PC

Freeware by ECTACO, Inc.
94 x 2102Kb downloads

...This LingvoSoft English Portuguese Talking Dictionary for Pocket PC provides two-way word translation and...synthesis of English speech. The new English Portuguese Talking Dictionaries for Pocket PC from LingvoSoft...with a non-European ROM. The LingvoSoft Free Talking Dictionary English Portuguese for Pocket PC has the following...on devices with a non-European ROM
* All English entries are complete with transcriptions and...
 
pronouncetranslateectacolingvosoftdictionaryspeak
Travel Dictionary Swedish HPC

Demo by TT- Software
47 x 7485Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
wincegermandutchspanishwindowscepotugueseitalianfrenchfreedictionaryenglish
Travel Dictionary Spanish HPC

Demo by TT- Software
59 x 8209Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
wincefrenchdictionarywindowscefreedutchgermanenglishpotuguesespanishitalian
Travel Dictionary Portuguese HPC

Demo by TT- Software
58 x 7787Kb downloads

...data can be viewed separately in the user dictionary or together with the original data in the...
 
freeenglishdutchwindowscedictionaryspanishitaliangermanfrenchwincepotuguese
...the drop-down lists. Currently supports two languages - English and American English. Provides a "forward" and "back"...up any word or phrase in an on-line dictionary (requires an internet connection). It`s FREE - there...
 
generatearabianrandomshakespearehumourmeditteraneaninsultshumorfreewaremodernfunny
JLearnItPDA

Freeware by Anthony Goubard
216 x 1501Kb downloads

...Danish, Norwegian, Hungarian and Latin * The same dictionary can translate from any language to any language...Dutch, German and Italian * Create your own dictionary with JLearnIt (e.g.: only frenchItalian) * Browse the...
 
spanishdanishgermanenglishhungarianitalianswedishjlearnitpdanorwegiantranslatorportuguesedutchfrenchvocabularylanguageslatin
Hunter Dictionary II

Freeware by www.graphichunter.com
42 x 2635Kb downloads

...Hunter Dictionary II is a free multifunction online dictionary for translating English word to Chinese, English or...Japanese. It is also an specialized dictionary for thesaurus and computing terms. Hunter Dictionary II...contains no dictionary database itself. Instead, it is a specialized Internet...user can use it to browse the online Dictionary Service (e.g. Yahoo Chinese Dictionary, MSN Encarta, Thesarus.com...
 
free online dictionaryenglish-to-chinesethesaurusenglish-to-englishmultifunctionthesaurus dictionarydictionary computingenglish-to-japanesefree dictionary
Hunter Dictionary

Freeware by www.graphichunter.com
34 x 2630Kb downloads

...Hunter Chinese Dictionary functions as an English-to-Chinese online dictionary. However Hunter...Chinese Dictionary contains no dictionary database itself. Instead, it is a specialized Internet...can use it to browse the online Internet Dictionary Service (e.g. Yahoo Chinese Dictionary) to achieve the...Chinese Dictionary function. It greatly improve the time used to...
 
chinese dictionaryenglish wordenglish-to-chinesefree dictionarytranslatefree online dictionarychinese meaning
Interlex

Freeware by Andrew Quilley
52 x 861Kb downloads

Free Vista Files award
...Interlex is a freeware vocabulary builder that helps you learn foreign words and phrases quickly and easily. The program is built around a simple idea: first you compile a list...
 
flashcardstrainingdictionarywordsdutchtesterspanishitalianfrenchportuguesevocabularyrussianswedishteachinglanguagelearningeducationalgermanbuildertestingtrainerhungarianpolishgreekforeignquiz
PicoZip Recovery Tool

Freeware by Softchitect
97 x 2794Kb downloads

...You have a choice of Brute Force or Dictionary based recovery methods. A 650,000+ words English dictionary...
 
brutepicozipwinzippassworddictionaryarchivezipfileforceunziprecovery