1 2 3 4 5 6 7

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AES Free

Freeware by Safe Soft Corporation
120 x 515Kb downloads

...AES Free is the program that creates self-extracting encrypted files for Windows. Self-extracting files are executable programs (EXEs) that contain a AES-file and the software necessary to...
 
passwordcodecompressdocumentssourceaesencryption systemcryptographic algorithmsshredderprotectingsecuritysoftwaresafetystream cipherfoldersfilesprograms
ABC CHAOS

Freeware by Safe Soft Corporation
113 x 439Kb downloads

...directory structures. For this it uses strong encryption, encryption acknowledged worldwide to be un-breakable....
 
securitytoolsfilesfolderssoftwarechaospasswordshreddersourceprogramsblowfishprotectingcompressrandomsafetydocumentsencryption systemnumbercryptographic algorithmsgeneratorcode
...CHAOS Generator is an application designed to generate passwords of any length and character content. CHAOS Generator will create alphabetic, numeric, alphanumeric or all keyboard characters passwords...
 
securitynumberchaossoftwaredocumentsencryption systemprogramsgeneratorprotectingcryptographic algorithmssourcerandomfilespasswordtoolssafetyfolderscode
CHAOS Shredder

Freeware by Safe Soft Corporation
319 x 195Kb downloads

...Windows does not physically remove deleted files from your hard disk. Emptying your Recycle Bin does NOT protect you at all. Your sensitive files can be recovered, even after you...
 
generatorstream ciphercompressnumbercryptographic algorithmsencryption systemsafetycoderandomchaosfolderssoftwarefilestoolspasswordprogramssecuritysourcedocumentsshredderprotecting
najitool GUI

Freeware by NECDET COKYAZICI
73 x 377Kb downloads

...programming functions like bin2c which makes a compileable source code file out of any file, like picture...completely free without any restrictions and with full source code. naji_gui can generate: - A list of...to 9999 - HTML pages with every possible Unicode letter/symbol - Preprogrammed .BMP pictures, nice for wallpaper...two secure file deletion functions - two file encryption functions And a lot more, enjoy!...
 
najitoolconvertencryptfreegeneratefilternajigui
...complicated Perl, PHP, ASP and Web DB, profound encryption algorithms, do not need to write a piece...
 
right clickjavascriptweb siteprotect images

Freeware by ComponentSpot
28 x 1347Kb downloads

...allows even less experienced programmers to add strong encryption and authentication services to their programs, security features...their projects more secure. Some of the symmetric encryption (private key) and authentication algorithms that cryptlib supports...· ssh It features various hashed message authentication code algorithms: · HMAC-MD5, HMAC-SHA, HMAC-RIPEMD-160 Finally, asymmetric (public/private...
 
encryption delphiencryption ocxencryption programmingencryption activexaes encryptionactive encryptionencryption componentencrypt visual basicencryption dllencryption library
...utility program that uses the free Diamond 2 Encryption Algorithm. Full source code and documentation of the...and author contact information has been updated. The encryption key may be a passphrase on the command...a file. You may use the included encryption/decryption source code in your own products at no charge....
 
securitydiamond2dlock2file managementencryptionutilitycryptography
...dsCrypt is AES/Rijndael file encryption software with simple, multi-file, drag-and-drop operations. It features...performance and safety measures. dsCrypt uses an advanced encryption algorithm and offers unique options for enhanced security....immunity to keylogger-infested environments - disclosed implementation and source code - secure use of system resources -...
 
privacyaesfilerijndaelencryptionperformancesecurity
Database Manager

Freeware by Inner-Smile.com
27 x 816Kb downloads

...Supported functions are: Table creation (generates table creation source code for BDE engine, Apollo driver, Advantage driver),...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport
LabVault Data encryption utility

Freeware by Labtam Inc.
9 x 1163Kb downloads

...our computer like e-mails, passwords, Bank account or source code information. Anything can be kept inside LabVault...
 
security softwarecomputer securitydata encryptiondata protectionfile encryptionfile protectidata securityfile lock
KeePass Password Safe

Freeware by Dominik Reichl
16 x 1300Kb downloads

...homepage, etc. Unimaginable. KeePass is a free open source password manager, which helps you to manage your...are encrypted using the best and most secure encryption algorithms currently known (AES and Twofish). For more...free, and more than that: it is open source (OSI certified). You can have a look at...its full source and check whether the encryption algorithms are implemented correctly....
 
opendatabasedisksecuritykeysecureencryptionsafemanagermastercodesourcefreepasswordkeepass
Advanced HTML Protector

Shareware by Creabit Ltd.
11 x 1741Kb downloads

...etc. It encrypts your Web Page using six encryption schemes and makes the source code impossible for...Protector can also compress a Web Page before encryption so that the size of the Web Page...
 
businessprotectdownloadssourcesoftwarehtmlwebsitecreabithidewebdesignpageencryptdevelopment
Absolute Database

Shareware by ComponentAce LTD
12 x 31708Kb downloads

Free Vista Files award
...Absolute DB is written completely in Delphi, full source code is available. Absolute DB is a great...third-party DB-aware controls; Strong encryption; BLOB compression; Full source code available; Royalty-free; Free for personal use; Ease...SQL scripts; Parameters in queries; Small size of code added into the application by the database engine...
 
single file databasedatabase delphibde alternativebde replacementdelphi databasedatabase component
...contain HTML mark-up and VBScript script inside. 4. Encryption of JavaScript, JScript, VBScript code in a file...or embedded in HTML page using Windows Script Encoder method (emulation of screnc.exe by Microsoft.) 5. Compression...with an original document. 9. Scrambling of C/C++/MFC source code files into solid code chunks making them...correctness of JScript/VBScript code. 11.
 
decoderencoderscrencscripts encryptormfcwindows script encoderjavascriptsourcewindows script decoderencryptionsource codejscriptjavascript obfuscatordecryptionvbscriptscramblingde-scramblinghtml
AeroTags TagsLock Pro

Shareware by AeroTags Software
11 x 1045Kb downloads

...the content of your web pages and hide source code of your HTML and XML documents? There...VBScript. The protection helps you to hide the source code of HTML and keep your intellectual property...that use JavaScript and ASP (Active Server Pages). Encryption helps you hide the source code of HTML....
 
protectenhancewebdesignwebsiteblockantispamemailcontentextractors
SourceGuardian PHP Encoder

Commercial by SourceGuardian.com
17 x 22425Kb downloads

...your PHP scripts. Main feature list: + Full Bytecode Encryption - protect your files by removing the...original PHP Source Code + Fully encode and deploy for PHP5 (and PHP4) + Choice...Windows/Linux/Mac OS X encoding clients + Command line encoder available now + Encrypt to domain name +...
 
encryptionsecurityphp protectphp encoderobfuscationencrypt phpprotectionscript encodingphp encrypt
phpSHIELD PHP Encoder

Commercial by phpSHIELD.com
20 x 1727Kb downloads

...have to give away all of their legacy code during a project - phpSHIELD will allow them...begin protecting your scripts immediately. Encrypted and protected code works under Windows, Linux and now Mac OS...X. Your encoded scripts will work with no changes to the...installations of PHP. Features: - Fully native byte code encoding: Native encoding to fully protect your application...
 
php encodersource code protectphp securityphp protectencrypt php
Advanced HTML Encrypt and Password Protect

Shareware by AEVITA Software Ltd.
13 x 1332Kb downloads

...allows you to encrypt HTML pages with strong encryption algorithms and protect them with a password. The...program will prevent anyone from viewing the source code or stealing your art work. Encrypted pages will...Advanced HTML Encrypt and Password Protect offers three encryption schemes including Simple, Medium and Strong encryption. The...in Perl, PHP, ASP or versed in profound encryption algorithms.
 
html encrypt password protectweb page encryptright clickdisable text selectionweb encryptinternet encryptionlockweb sitepassword protection software
secureSWF

Demo by Kindi
25 x 3687Kb downloads

Free Vista Files award
...Publish with confidence and stop giving away your source code with every SWF file. secureSWF protects SWF...advance Flash and Flex ActionScript obfuscation, optimization, and encryption making it the unquestioned market leader. In addition,...
 
actioscriptobfuscatorsecurityswfflashflexprotectionencryptionobfuscation