1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AxCrypt

Freeware by Axantum Software AB
66 x 3413Kb downloads

...Password protection for files using strong encryption for Windows 2003/XP/Vista/7/2008 using the AES algorithm with...128-bit keys. It combines strong symmetric encryption with compression and double-click editing/viewing. Encrypted files have...and are shown with a new icon. To encrypt a file, right-click it in Windows Explorer and...`AxCrypt | Encrypt`. To edit or view an encrypted file - just double-click it. To decrypt, right-click...
 
gplopen sourceapiencryptserverencryptiongnushell extensionfilewindowsaesfreescriptmultiple backup
Backup4all Professional

Shareware by Softland
27 x 82857Kb downloads

Free Vista Files award
...Backup4all is an award-winning backup program for Windows. Backup4all protects your valuable data from partial or total...loss by automating backup tasks, password protecting and compressing it to save...storage space. Using Backup4all you can backup to any local or network drive, backup to...Amazon S3/Azure, backup to SFTP/FTP (with support for SSL encryption, proxy...
 
zip encryptionfirewireftp backupdifferential backupincremental backupfull backupdata backupmirror backupbackup dvdbackup open filesusb backupbackup softwareoutlook express backupbackup4all
Acronis True Image Server for Windows

Commercial by Acronis
35 x 150195Kb downloads

...is the most reliable, flexible and easy-to-use server backup solution ever! Backup data and program files in...Acronis Universal Restore allows you to restore your backup files to different hardware or to a virtual...can image your whole server or implement granular backup and recovery of selected files and folders. You...may schedule backup tasks, compress and encrypt images, exclude certain types of files from backups...
 
serverwindowsacronisimagetrue
WinXP Manager

Shareware by Yamicsoft
45 x 5285Kb downloads

...and find opened ports; tweak your IE easily; backup all data in Outlook Express; automatically check invalid...
 
repairoptimizefixcleanspeedmaintaincustomizetunetweakoptimizationfastertweaker
SourceGuardian PHP Encoder

Commercial by SourceGuardian.com
33 x 22425Kb downloads

...PHP scripts. Main feature list: + Full Bytecode Encryption - protect your files by removing the original...clients + Command line encoder available now + Encrypt to domain name + Encrypt to IP +...interface and Advanced mode in GUI + Automatic backup of source files + Deployment options + Lock...
 
encryptionsecurityphp protectphp encoderobfuscationencrypt phpprotectionscript encodingphp encrypt
Dekart Private Disk

Shareware by Dekart
25 x 3407Kb downloads

...Powerful, reliable and flexible disk encryption program that lets you create encrypted disk partitions...be allowed to access the contents of the encrypted drive. This feature protects your data from external...data are now truly portable, as you can encrypt your information on USB flash drives, CDs, DVDs...from accidental data loss. The reliability of the encrypted container is further enhanced by the built-in backup...
 
data protectionvirtual encrypted diskdisk encryptionstrong disk encryptiontransparent encryptionaes encryption
WinZip

Shareware by WinZip Computing
113 x 860Kb downloads

Free Vista Files award
...browsing, copying, moving, renaming and deleting—and trusted compression, encryption and sharing, WinZip 19 offers a whole new...
 
jpeg compressionarchivebest compressionzip fileencrypt fileslhacompress filesunzip fileszipxextractphoto compressiondecryptfile compressionbackup datararself extractorbz2aeswinzipfile encryption
...of sensitive data is often neglected. Only an encryption provide a full protection of the files on...menu of the File Explorer. With the Easy Encryption technology (EEnTe) only a few steps are necessary...creating and editing compressed ZIP archives, whereby the encryption and signing also supported. Functionality abylon PASTE optimise...are not copied, from changed files make a backup and after moving the source files to the...
 
codecopypasswortscramblersymmetricsearchcodingfindimage-inputsignusb-stickencodeasymmetriccryptexplorerzipencryptionsecurityemailmovesmedigital envelopchip cardsmart cardcompresswipepkcs
Bookmark Buddy

Shareware by Edward Leigh
21 x 724Kb downloads

Free Vista Files award
...Organize your bookmarks/favorites, shortcuts and logins simply, quickly and reliably with this intuitive, feature-rich bookmark and login manager: To retrieve a bookmark quickly: - Navigate to any bookmark in...
 
backupbookmark managerexportlog-insfirefoxshortcutscheckinternet explorerfavorites organizerloginsoperaimportconvertbookmarksencryptfavourites organiser
Bookmark Buddy Unicode Edition

Shareware by Edward Leigh
16 x 729Kb downloads

Free Vista Files award
...formats. Insure your bookmarks with Bookmark Buddy`s 3-stage autobackup and undelete facility. Use any web browser and...
 
importlog-inshortcutsaolexportencryptmozillabackupfavourites organiserfavoritesbookmarkscheckloginnetscapeconvertfavorites organizerbookmark manager
CompressionMaster Suite

Shareware by ComponentAce LTD
19 x 37254Kb downloads

Free Vista Files award
...solution for developing applications with data compression and encryption capabilities. The CompressionMaster Suite consists of: 1) FlexCompress...applications. This solution provides flexible compression and strong encryption algorithms that allows you to integrate archiving or...toolkit has everything you need to compress and encrypt files, streams, strings, data packets and even BLOB...
 
zipbuilder compressionspanningencryptionmulti-diskstreamdelphi
Calendarscope

Shareware by Duality Software
29 x 4260Kb downloads

Free Vista Files award
...Calendarscope is a full-featured calendar program for planning, managing, and scheduling appointments, meetings, birthdays, vacations, important dates, special events, and tasks. It allows you to view all your events...
 
webhandheldandroidblackberrysecuritymemopasswordtaskbackupiphoneappointmentcalendarscopeorganizerencryptalarmreminderschedulemonthto-doplannerpimpalmweekipadevent
DoubleSafety

Shareware by Power Labs
19 x 2856Kb downloads

Free Vista Files award
...your data remains safe. You can also automatically encrypt data using the 256-bit AES algorithm, the world...you will be able to access confidential information. Backup programs often have a problem copying files that...
 
best backup programcomputer backup systembackup utilitybackup utilitiesdata backup software
Renaissance TM 2008

Shareware by CompuApps, Inc
17 x 3634Kb downloads

...Introducing Renaissance SE, a powerful Backup application that can encrypt and decrypt data using...Comprehensive scheduling options allow the user to do backups at idle time. Intelligent Restore options help user...to set up and manage Fast, Reliable, Secure backups Smart Restores with unparalleled accuracy Backup to hard...removable disks Simplifies media management Major Functions Dual Backup & Protection Zero-Touch Backup™ Value...
 
restoreduplicateinstant backuppassworddisaster recoveryfile backupfolder backupcompressionimagingscheduled backupaesaes128 encryption decryptionschedulerautomatic backupone touch backup
Simply Safe Backup

Freeware by Cannon Technologies
37 x 2462Kb downloads

...busy Network Administrator! With the ability to burn backups to CD & DVD or backup to tape,...send backups to an FTP server or (network) file (server)...any hassle. It`s safe: Choose our ultra secure backup file format, or an industry standard (less secure)...zip file. Simply Safe Backup offers data encryption, compression AND the ability to...burn backups to CD & DVD, or write to tape...
 
file systemcd-rcompressionwindows 2000ftpremoterecoverysafedisastercompressedhandy backupdvd-rpkzipeasyopticalveritaswinzipsimplynetworkcrashstompdvdrencryptencryptedcompare
FileWrangler

Shareware by CursorArts Company
35 x 2893Kb downloads

Free Vista Files award
...read and write Windows CAB files, or create encrypted LOK format archives. You may view and run...normal delete, and recycle file deletion options; - Encrypt and decrypt files (trial version uses methods allowed...viewer; - On-board editors: text, paint, html; - Backup and Restore functions; - File splitter which allows...
 
managerprintunziphidewipesearchsynchronizeeditlistingssplitterspanlistsfilespatchingmanagementftpcabcompressionarchiveexplorerencryptsplittingviewerfindcopypatcher
Antilop Info Organizer

Freeware by AntilopSoft
27 x 1026Kb downloads

...important information in groups and subgroups. You can encrypt your data with safe Blowfish encryption algorithm up...browse your data as they would not be encrypted (decryption is done automatically using one application key)....- photos etc., notice that you can browse encrypted images in Antilop Info Organizer as they would...are encrypted. With Antilop Info Organizer you can: encrypt your data with secure Blowfish algorithm with up...
 
usernamedatafile linkorganizerpasswordwriteencryptedpressdecryptedfilespicturedocumentstoredantilopinfopinspreadsheetcontactsurldecryptionapplicationmemo
Advanced System Optimizer

Shareware by Systweak, Inc.
32 x 10230Kb downloads

...these files can never be recovered. The Secure Encryptor lets you add password protection to sensitive files....efficiently. The suite has a number of built-in backup and recovery tools, and includes Undelete utility that...
 
boostclean systemdefragrealtimeprivacysecurity adviserdisk infoencryptspywarebackupregistrytune-upspeedmemorydisk spaceoptimizemaintainduplicate filedecryptsecuredrivergame performancerecoveryundelete
FileGee Backup & Sync Enterprise Edition

Shareware by FileGee
9 x 7107Kb downloads

...1.Achieve backup and synchronization between the computer hard disks, between...any two out of the three. 2.Can hot backup database files, can read the file locked by...independent multi-job mode, the software can execute different backups or synchronizations for different file folders simultaneously. 9.Support...one-way synchronization, bi-directional synchronization, incremental backup, full backup and other types of file synchronization and...
 
backup filesbackup and sync softwarebackup files with ftpsynchronize files
NativeWinds Database Manager

Shareware by NativeWinds
26 x 3072Kb downloads

...Powerful SQL language with wizard interfaces. Ability to encrypt and password protect your tables. Ndb provides a...view (and run reports on) filtered data. 9. Backup and restore your databases thru a wizard interface....
 
manageexportdatabasemail-mergeimportcreatereports