1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Keepoint 7

Freeware by Saora Inc.
13 x 6308Kb downloads

...only, images only, with or without annotation) via email * Automatic and Intelligent sorting/organizing of stored content...
 
saorabeyond search enginesinternet explorer addonweb research softwareannotatekeepoint prooffline browseradvancedweb information manageroffline browsing toolsoffline web browsingweb research engine
Outlook Email Verifier

Shareware by eTopping Software
19 x 900Kb downloads

...the old addresses. Is it possible to check email addresses quickly for their validity? Is it possible...to check all email addresses in Outlook mailboxes at once? Yes, now...it is possible with Outlook Email Verifier plug-in. It is very easy to use:...and provides a report of dead and existing email addresses. The program has several exclusive features such...
 
outlookbccmessageautocompleteautofillingautomatic filling
Actual Contacts for Outlook

Shareware by MAPILab Ltd.
11 x 7671Kb downloads

Free Vista Files award
...add-in for updating your address book and monitoring validity of e-mail addresses in the contacts. Select the...inform you about the contacts that contain invalid email addresses. The add-in also supports validation of the...
 
contactemailmsoutlookupdate contacte-mailaddinpluginverify contactsmailing listcheck contactsadd-inusers groupscheckingoutlook softwarecontacts verifingaddonoutlook contactsdistribution list
Free Vista Files award
...Maintain clean mailing lists checking the validity of recipient`s e-mails addresses. eMail Verifier can save...needs to maintain a clean e-mail contact list. eMail Verifier is your powerful solution for the standard..."message delivery error." Email Verifier verifies every e-mail address from a given...list, allowing you to determine 80-90% of "dead" email addresses. eMail Verifier works on the same algorithm...
 
e-mailvalidemailcheckerverifieraddressmailboxvalidity
Form1 Builder Software

Shareware by softSWOT
9 x 104Kb downloads

Free Vista Files award
...single file form (no cgi) with a hidden email delivery address and an extensive range of benefits...and options including protection against form hijacking, email injection and email harvesting. Key features include: User...server side php scripting and protects your delivery email address from email harvesters. Fully server based, no...user Cookies and Variables. Detects Required variables. Includes email validity checks.
 
softswotsecure formform1build formsform creationweb form builder
Free Vista Files award
...other COM environment application to send rich text/HTML email using the SMTP/ESMTP protocol. ANSMTP supports all operations...attachments and embedded pictures; - import text/html to email body from specified file; - support "AUTH MSN"...- add customized headers in email; - save email as specified file; - support normal recipient, carbon..."AUTH LOGIN" authentication; - DNS lookup to send email without specified smtp server; -test validity of...
 
sslmimesendmailsecuretcpemailtcpipdns lookuppopcomponentsmtp ocxadminsystememailarchitecttlsipv6activexesmtpoutlooklibraryimap4dll
1st Email Address Verifier

Shareware by 123HiddenSender.com
27 x 1087Kb downloads

Free Vista Files award
...1st Email Address Verifier (EAV) is a program that verifies...the validity of e-mail addresses in mailing lists.The program works...the message back with remark about it. 1st Email Address Verifier can save time and money for...files. Allows you to save successful or failed email addresses to separated files, it supports to remove...duplicate email addresses automatically....
 
email address verifier1st email address verifier
KingMailer

Shareware by SharewareDreams
15 x 1260Kb downloads

...unsubscribing. Import & Export of profile. Checks the validity of email instantly. Filter conditions. Outlook Address book...
 
html maile-mailoutlookemailmssqlmail managementbulk mailermass mailermailing listsmtp mailerdirect mail
Super Email Verifier

Shareware by flashemailcast.com
17 x 1180Kb downloads

...Super Email Verifier is a program that verifies the validity...not. Nothing is sent to the recipient. Super Email Verifier can find about 95% of dead addresses....Super Email Verifier can save time and money for businesses...mail contact list. It supports to remove duplicate email addresses automatically. It supports to export verified results,...allows you to save successful or failed email addresses to a Text, CSV, TSV or Microsoft...
 
email validemail verify
MarketSMS

Shareware by RIA Software Company
14 x 3417Kb downloads

...information! Main features: Supported phones - GSM modems, Email servers, Nokia phones, any AT command supported phone...messages - Different SMS sending types - SMS validity - Authorization request - Running as server (process...
 
databasemotorolafaxmarketmobilemailreceivesmssendsony ericssonnokiasiemensserverphonesamsunginformation
Advanced Maillist Verify

Shareware by EMMA Labs
19 x 3538Kb downloads

...Verify (AMV) is a program that verifies the validity of e-mail addresses in databases, address books and...
 
vrfyaddress verificationverifyingverifingdeadeverifymailaddress correctioncheckingvalidatorcomponentdelivery erroremail verifierwabvalidationmailing list managercheckermailverifyamve-verify
...mail accounts from which you want to extract email ids. File Management - You can create list...of extracted unique email ids from your mail account. You can recursively...extract email ids from remote sites, from local html files...merge contact lists to create list of unique email ids. This increases the performance of your contact...list. Email Spider has built-in Email Verifier and Validator. You can create your contact...
 
url spideremail marketingemail validatoremail verifieremail spideremail extractor
GSA Email Verifier

Shareware by GSA
11 x 10930Kb downloads

...GSA Email Verifier verifies email addresses from mailing lists, Microsoft Outlook contacts, Windows...tool or by predefined rules which set an email automatically to valid, invalid or remove them from...the list. This email validator is a very powerful and reliable multithreaded...program, capable of handling large volumes of email addresses providing high speed email verification (with over...100.000 email verifications per hour).
 
email validateverify emailcheck emailsmail validatoremail listemail verifier
Email Validation Software

Shareware by Sobolsoft
4 x 797Kb downloads

...Verify email addresses. Save valid and invalid results as a...
 
websitescheckermultiplebigmarketingvalidityvalidatemassvalidatorlistbulkverificationcheckinginboxe-mailingemailsverifiere-mailsdifferenthttoutlooksendingaddresses
Free Vista Files award
...This FREE software checks for existence of an email address. It verifies / validates email addresses in...multithreaded engine. Use this tool first before sending emails to a huge list to reduce bounce back...does not work due to port blokage. Vodamail Email Verifier uses different ports for validating email address....This features makes it the only available working Email Verifier in market. # Vodamail Email Verifier connects...
 
email address validationemail verificationtest emailinvalid emailsemail verifieremail address verificationemail validatoremail validitydead emailsclean email liste-mail verifyemail validationcheck email
Email Validation Tool

Shareware by troyeesoft.com
5 x 1454Kb downloads

...to use, powerful and reliable utility and first email verifier to verify and clean up your mailing...list. Email Validation tool instantly verifies the validity of email address or domain from mailing lists,...if they are still valid. Simply provide an email address list and verifier will return a valid...or invalid email by contacting SMTP servers to validate an address...an actual email.
 
verify email addressemail cleaneremail validatoremail validation softwareemail verification toolemail list managementdomain validation programbulk e-mail verifiercheck domain
Advanced Maillist Verify

Shareware by EMMA Labs
2 x 3538Kb downloads

...Verify (AMV) is a program that verifies the validity of e-mail addresses in databases, address books and...
 
checkere-verifydelivery errorverifyingamveverifycomponentvalidatorvalidationwabcheckingvrfymailaddress verificationemail verifieraddress correctionmailing list managerdeadmailverifyverifing
Lepide Active Directory Manager

Shareware by Lepide Software
3 x 4515Kb downloads

...mailbox settings, mailbox features configuration, add, modify, remove email addresses and permission settings for mailboxes. Free trial...
 
windows active directoryactive directory managementactive directory manageractive directory reportingmanage active directoryactive directory reports
...Email Checker Basic: check and verify whether the email address is valid (format or syntax) and really...existing on the corresponding email server without sending in SINGLE mode. Usually, it...is used to maintain a clean emailing list. It`s very easy to use: just input/paste...the email address and press , the result will show...result contains status (OK/BAD), Description and Interaction between Email Checker Basic and email server.
 
check email addressverify emailemail address checkerverify email address
EmailValidator

Demo by Dimplesoftwares
1 x 258Kb downloads

...New Features 1 Supports Visual Studio 2005/2008/2010. Email Validator 2.1 supports Visual Studio 2010. 2 Supports....Net Framework 4.0. Email Validator 2.1 supports .Net Framework 4.0. For Email...Sample Code for Windows with Visual Studio 2010. Email Validator 2.1 includes new demo with Sample Code...can test it by downloading it from Download Email Validator 2.1 for windows 4 Added new Demo...Sample Code for Web with Visual Studio 2010.
 
email validatoremail validationemail verification componentemail validation componentemail verifieremail address validatoremail address verificationemail address checkeraspnet email validator