1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...What is the need for encrypting email messages you might ask yourself? But if any...a powerful, highly configurable, yet easy to use email client. It is also a public key email...automatically encrypts all your messages and an anti-spam email client that automatically classifies incoming emails as spam...to do any additional operations to make your email secure. It also supports drag and drop attachments,...
spamsecuritysafeemailclientexpressprotectpublic keyencrypte-mail
SPAM Shredder

Freeware by Safe Soft Corporation
110 x 1269Kb downloads

...SPAM Shredder is an anti-spam email client that automatically classifies incoming emails as spam...or non-spam. SPAM Shredder is a spam filtering software that lets you remove spam emails...server without pulling them down into your Inbox. SPAM Shredder ensures the efficient and easy control under...to save your time and money! Applying the SPAM Shredder allows to determine up to 99.9% of...
clientencryptsecuritye-mailsafepublic keyexpressemailspamprotect
Mach5 Mailer

Freeware by Mach5 Development
114 x 9854Kb downloads

Free Vista Files award
...of email! Simple, Free, and Effective. Send personalized email messages to customers, from any database source including...fast multi threaded delivery, then process the return email with ease. Your contacts get a personal message...your database. Includes PopMonger Gold 3.5, a scriptable email handling utility, to conduct confirmed opt in management,...Note.
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...NoSpamToday is a e-mail spam filter (SMTP/POP3) compatible to every known mail server...flexible filter pipeline architecture allows combining the award-winning SpamAssassin filter, an attachment blocker, a remote blacklist filter...send non-delivery notifcations to forged sender addresses. With NoSpamToday you have online access to view statistics charts...real-time using a web browser, or using the NoSpamToday admin application.
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server

Freeware by Comodo Inc
93 x 10370Kb downloads

...Comodo AntiSpam Desktop 2005 is an intuitive, easy-to-use, client-based software...product that eliminates spam forever from the computer`s email system. No license fees - No charges -...enjoying a 100% clean inbox. Highlights of Comodo AntiSpam Desktop 2005: - Total Spam Elimination - never...hassle set-up - install in seconds for instant spam free email - Maximum Protection - Minimum Drain...
free antispam toolfree antispam softwaredesktop antispam toolantispam free download

Freeware by JAM Software GmbH
58 x 14619Kb downloads

Free Vista Files award
...Everyone owning an email address knows these annoying mails you receive. The...number of spam mails running around is continuously increasing so everyone...from spam. Don`t waste time on this let SpamAware do it for you! SpamAware is a plugin...Outlook Express and Windows Mail (Vista). It uses SpamAssassin to score new incoming mails and decides based...with the mail.
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
SPAMfighter Standard

Freeware by SPAMfighter
451 x 2529Kb downloads

Free Vista Files award
...Express, Windows Mail, Windows Live Mail or Thunderbird. SPAMfighter is easy to install and use. With SPAMfighter...You are also protected against the dangers of spam and phishing mails, such as harmful attachments, and...identity theft. Download SPAMfighter and protect your computer and personal information in...minutes. SPAMfighter works in a unique way by harnessing the...
microsoftthunderbirdjunkantispameatermailfilterantipuboutlookfreeanti-pubphishingblockerspamkillerspam filterfreewarejunkmailspammersspammingexpressmozilladownloads

Freeware by Spacejock Software
78 x 3096Kb downloads

Free Vista Files award
...yMail can be used as a spam cleaner for your existing email setup, and also...as a standalone email client. yMail`s spam filters use Bayesian techniques. You can show yMail...which messages are spam and which are not (before you even download...scanner - you don`t have to use the email portion of the program, just use yMail to...preview and automatically delete spam before downloading into your regular email software. Free...
Accurate Spam For Outlook Express

Freeware by Accurate Solutions
37 x 1022Kb downloads

...Accurate Spam Filter For Outlook Express filters spam from your outlook express. It is designed to...quickly remove spam from your inbox in Microsoft Outlook Express. The...software helps you monitor, block spam when necessary. it`s automatically filtered for all user...when several users report same spam email. It is a excellent Outlook Express Mail...utility for its simplicity and advanced abilities.
spamfilteroutlook express
...Simple tool provides code to cloak HTML email addresses to prevent harvesting by spam spiders....
web site designweb serverweb hosting servicesweb page designweb site trafficweb page hostingweb servicehtml toolsfree web hostingweb site hostingweb design freeware

Freeware by 7tec.com
30 x 287Kb downloads

...the internet, checking e-mail as it is received. Spam is automatically moved to the deleted items folder....free, effective and very easy to use. Because spam is a moving target which requires program changes,...
Spam Sleuth Lite

Freeware by Blue Squirrel
28 x 3629Kb downloads

...the scenes and analyzes e- mail messages for spam and virus characteristics. If Spam Sleuth Lite determines...your e-mail program gets your e- mail, the spam has already been removed and you can read...you would enter *@bluesquirrel.com. Turing Test: Sends an email back to the sender and requires them to...enter a validation code in order for Spam Sleuth to allow email messages through to your...
killerihatespame-mail filterjunk e-mailspammersanti-virusvirusscanantivirusonline applicationsblue squirrel

Freeware by AGM
37 x 2037Kb downloads

...Quick reply or compose email, flash message other Spamdel users, categorises spam and lets you view and...it reaches your PC and more. Advantages of Spamdel over other mail utilities include its many features,...ease of use, and inter-operability with any email program eg Outlook Express, Outlook, TheBat! and so...on. Unlike most other email utilities, Spamdel does all its work on the server which...
utilitydeleteanti-spamsecurepop3outlook expresssmtpfreewareanti spamsecurity

Shareware by Beiley Software
29 x 527Kb downloads

...is an Outlook add-in for sending individual, personalized, emails to your mailing list. Send personalized emails to...reduces chances of your messages being blocked by spam filters. You control the rate at which emails...all the power of Outlook, send from any email account, text or HTML messages, attachments, adjustable character...
broadcastannouncementsemail marketingnotify customersnewslettereannounceradd-inbeileysoftwareoutlook
Nelson Email Organizer - NEO Free

Freeware by Caelo Software Inc.
56 x 12054Kb downloads

...add-in, NEO Free turns Outlook into a powerful email organizer giving you the instant searching and effortless...a dozen awards (including CNET Top 100 Best Email Organizer) and have had over 100 positive reviews....work just as before. NEO Free organizes your email by creating a separate catalog that is completely...
add-onsearchingbulk mailcommunicationsproductivityexchangeorganizationspamplug-inbusinesse-mailemailorganizerindexersimplefreepluginaddonautomaticoutlookadd-invirtualaddin
Lockspam Free

Freeware by Polesoft Inc.
62 x 12133Kb downloads

..."Lockspam Free 3.0" is free anti spam filter software for Microsoft Outlook, Outlook Express and...Eudora. It safely kills the spam and protects your innocent mails. Lockspam adopts Polesoft...unique patent-pending anti spam technology which laid multi-level protection to your Inbox....Spam are safely quarantined in Polesoft Antispam folder. We guarantee 100% satisfaction. Polesoft encourages users...
outlookspam guardemail filterspam stopperspam freespam blockerspam fitlerspam killeranti spam software

Freeware by Beiley Software
55 x 723Kb downloads

...is an easy to use, yet powerful bulk email client. Use AutoMSW to send individual, personalized emails...messages quickly with parallel threads. You can send email using the built in SMTP server, your own...ISP`s SMTP server, or your MAPI email client (such as Outlook Express). It includes mail...a "Verify" mode so you can validate your email addresses without actually sending a message. Global and...run AutoMSW unattended from a batch file.
dkimmailing softwareemail marketingnewsletter email softwarenewsletter mailerdirect mailbulk emailgroup emailermass emailemail sendergroup mailerbulk email softwaree-mailemail marketing software

Freeware by Tortuga Group LLC
24 x 1000Kb downloads

...Delete SPAM using a domain blacklist. Automatically extract domains from...
...Ella for Spam FREE is the first Smart Inbox Assistant which...to personally organize and automate the processing of email messages from within the Outlook Inbox. By using...integrated training toolbar, users simply provide Ella for Spam FREE a few examples of messages to keep...are moved, continuously refining the model of user`s email sorting behaviors. FREE version adds 2 line promotional...signature to outbound email - purchase version does not....
email organizeroutlook spam filterspam killerbayesian filteremail sorteranti-spamemail managementemail classificationstop spamspam blockerspam emailanti spam software