1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Outlook Email Verifier

Shareware by eTopping Software
19 x 900Kb downloads

...the sorting of Outlook contact list, deleting old addresses that do not exist anymore, adding new ones....we do not have any problems with new addresses adding but it is not so easy when...the old addresses. Is it possible to check email addresses quickly for their validity? Is it possible...to check all email addresses in Outlook mailboxes at once? Yes, now it...is possible with Outlook Email Verifier plug-in.
 
outlookbccmessageautocompleteautofillingautomatic filling
Actual Contacts for Outlook

Shareware by MAPILab Ltd.
11 x 7671Kb downloads

Free Vista Files award
...is a Microsoft Outlook add-in for updating your address book and monitoring validity of e-mail addresses in...be able to update their data in your address book by filling out the form. This program...inform you about the contacts that contain invalid email addresses. The add-in also supports validation of the...message sending and finishes the session correctly. So, address verification is technically correct and cannot be noticed...
 
contactemailmsoutlookupdate contacte-mailaddinpluginverify contactsmailing listcheck contactsadd-inusers groupscheckingoutlook softwarecontacts verifingaddonoutlook contactsdistribution list
Free Vista Files award
...lists checking the validity of recipient`s e-mails addresses. eMail Verifier can save time and money for businesses...needs to maintain a clean e-mail contact list. eMail Verifier is your powerful solution for the standard..."message delivery error." Email Verifier verifies every e-mail address from a given mailing list, allowing you to...determine 80-90% of "dead" email addresses.
 
e-mailvalidemailcheckerverifieraddressmailboxvalidity
Advanced Email Verifier

Shareware by G-Lock Software
4 x 13283Kb downloads

...a clean mailing list and remove bounced, undeliverable emails because a lot of ISP mail servers have...been known to block a sender`s email domain for repeated sending messages to non-existing email...addresses. With the Advanced Email Verifier you can: -Clear your email list or database...from bounced and undeliverable email addresses that allows you update and keep your contact...proactive basis.
 
email checkercheck bad emailsemail verifierverify invalid emailslist cleaner
...most rewarding. Besides acquiring and storing subscribers e-mail addresses database there is another important task - periodical...email address verification. People tend to use several e-mail addresses...well as they tend to give up those addresses overwhelmed by spam. And everyone loves a new...check the mailing list for so called `dead` addresses every here and then. However, since most e-mail...
 
mailing listemailmail listmaillistvalidatecheckverify
Free Vista Files award
...Keep your email lists up to date and remove email addresses...just have to define the path of your email lists. As a result you receive a list...with guaranteed valid email addresses, a list containg probably valid email addresses...and a list with invalid email addresses. The EmailVerifier uses a proper proofing mechanism, because most of...
 
email verifieremail validatoremailverifiernewsletteremail tester
Power Email Verifier

Shareware by TEC Software
23 x 5698Kb downloads

Free Vista Files award
...Power Email Verifier can check your email lists for valid emails. It can import large...lists with no problem. Uses multithreading to verify emails at a very fast rate. Simulates the sending...of email without sending any messages. Program supports the following...file formats: delimited, text, csv - windows address book, and over 7 mail list formats. Verified...
 
utilitiesbulkverifypoweremailmarketingadvertisingverifier
BulkVerifier

Shareware by WebExtractor System
11 x 1358Kb downloads

Free Vista Files award
...BulkVerifier, an efficient multi-threaded application for checking e-mail addresses and domain availability. Quickly and easily verifies email...domain list. A powerful advanced bulk domain and email validation tool. BulkVerifier offers you two processing modes...fast and deep. In its fast mode BulkVerifier works extremely fast being able to process mailing...
 
email validationdomain verifieremail verifiere-mail verifieremail list cleaner
Smart Email Verifier

Shareware by DeskShare
12 x 4112Kb downloads

Free Vista Files award
...Smart Email Verifier will check every email address from a given mailing list and determine if...e-mail box on the SMTP server.
Smart Email Verifier can save time and money for businesses...person that needs to maintain a clean e-mail address list.
Supports all popular file formats; Excel,...Oracle, MySQL, MS Access and others.
Smart Email Verifier works with Windows 98, Windows 2000, Windows...
 
validate emailsmtp checkverify emailemail syntax
1st Email Address Verifier

Shareware by 123HiddenSender.com
27 x 1087Kb downloads

Free Vista Files award
...1st Email Address Verifier (EAV) is a program that verifies the validity...of e-mail addresses in mailing lists.The program works on the same...algorithm as ISP mail systems do. Mail servers addresses for specified address are extracted from DNS. The...as soon as mail server informs whether this address exist or not. EAV can find about 90%...of dead addresses - some mail systems receive all messages and...
 
email address verifier1st email address verifier
...Full Version Trials of Edge Group Mail. Group email and imported lists. Set up unlimited groups in...your address book. Enter unlimited contact information in each group....email, first name, last name. Import to your address book from text file or clipboard. Search Filters...Import Emails Comprehensive Merge Tool will merge your address book files according to any salutation configuration you...choose.
 
email marketingnewsletter managementgroup mailemail advertisingemail newslettergroup email senderemail managementbulk maileremail verifiermass mailerbulk mail sendermass email software
Super Email Verifier

Shareware by flashemailcast.com
17 x 1180Kb downloads

...Super Email Verifier is a program that verifies the validity of...e-mail addresses in mailing lists. The program works on the...directly to their SMTP server to check the address you. It does not come to the message...as soon as mail server informs does this address exist or not. Nothing is sent to the...recipient. Super Email Verifier can find about 95% of dead addresses. Super...
 
email validemail verify
High Speed Verifier

Shareware by EMMA Labs
10 x 3858Kb downloads

...High Speed Verifier (HSV) is a high-speed software designed to check...e-mail address for existence. HSV is capable of checking thousands...of addresses per second. It can easily deal with mailing...be achieved. HSV detects about 20-30% of invalid addresses in a mailing list, though theoretically it is...checking (with which the rest 40% of dead emails could be detected) takes 10 times longer and...
 
verify emaildead emailclean mail listmailing list verifyemails verificationemail verification
Advanced Maillist Verify

Shareware by EMMA Labs
19 x 3538Kb downloads

...a program that verifies the validity of e-mail addresses in databases, address books and mailing lists. Now...algorithm as ISP mail systems do. Mail servers addresses for specified address are extracted from DNS. The...as soon as mail server informs does this address exist or not. AMV can find about 90%...of dead addresses - some mail systems receive all messages and...
 
vrfyaddress verificationverifyingverifingdeadeverifymailaddress correctioncheckingvalidatorcomponentdelivery erroremail verifierwabvalidationmailing list managercheckermailverifyamve-verify
...Hotmailer is a bulk email sender, email address finder and verifier. It can efficiently search large...amount of e-mail addresses from a mail server in a short time....will connect to the remote server and post email addresses for verification. If the email address is...
 
bulk mailerfast bulk mail sender
Live Email Verifier

Shareware by Live Software Inc
17 x 1229Kb downloads

...Email Verifier quickly and easily verifies email addresses. Email Verfier removes invalid, not existed and dupicate emails....emails. Features: 1. Very Fast: check 50 000 emails per hour 2. Huge Mailing Lists : 1...000 000 email addresses and more 3. Support import from: Excel, Word,...Foxpro, Dbase (.dbf), Text (.csv, .lst) and more Email Verifier is designed for users who have their...
 
verify email addressvalid email addressemail verificationemail verifieremail validationvalidate email address
Live Email Validation Component

Shareware by Live Software Inc
23 x 1229Kb downloads

..."The Email Validation Component is a true native, 100% managed...can be implemented for both Webform and Winform." Email Validation Component does: 1. An accurate syntax check...3 lines of code and get 100% better email address validation. Email Verifier has fast and robust...SMTP server of the recipient and validates the email address without actually sending any mail. Keywords: verify...
 
email validationverify email addressvalidate email addressemail verifiervalid email addressemail verification
YL Mail Verifier

Shareware by YL Computing, Inc
5 x 2159Kb downloads

...YL Mail Verifier is a powerful and easy-to-use solution for the...this Mail Verifier, you can easily check every email address from a mailing list and determine if...the email addresses are still valid. it does three levels of...DNS and SMTP. it is the fastest e-mail verifier in the market today. YL Mail Verifier is...
 
mailverifier
Live Email Verifier Professional

Shareware by Live Software Inc
12 x 1946Kb downloads

...Email Verifier Professional quickly and easily verifies email addresses. Email Verfier removes invalid, not existed and...dupicate emails. Email Verifier is designed for users who have their own...to keep them up-to-date. The tool verifies every email address from a selected database or text file,...you to determine up to 90% of "dead" email addresses. Email Verfier supports all popular file formats...
 
valid email addressvalidate email addressverify emailemail validationverify email addressemail verificationemail verifier
GSA Email Verifier

Shareware by GSA
11 x 10930Kb downloads

...GSA Email Verifier verifies email addresses from mailing lists, Microsoft Outlook contacts, Windows address...Additionally you probably want to remove all administrative addresses such as support(at) or webmaster(at) to which you...tool or by predefined rules which set an email automatically to valid, invalid or remove them from...the list. This email validator is a very powerful and reliable multithreaded...
 
email validateverify emailcheck emailsmail validatoremail listemail verifier