1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Quick Startup

Freeware by Glarysoft Ltd
177 x 2381Kb downloads

Free Vista Files award
...When you turn on your computer certain applications, drivers, and services are automatically started...
 
uninstallcleanupfixrepairstartupremoveregistry

Freeware by Alexander Gjøsund
88 x 5672Kb downloads

...ErrMess Remote Computer is a freeware remote tool. You are able...your own icon, chat, download/upload files, view desktop, edit registry, shutdown, view visited urls, view taskmanager, hide...
 
freeware
...Control Center lets you control which applications your computer executes when it starts up. Startup Control Center...
 
startupadwareenablesureshotautostartsystemkeyloggerrunfreewarewindowsload orderboot orderexecuteapplicationcommandlinedisabledeletespywareeditrebootgatoraddregistry
...is the most remarkable security product for a computer you have seen. Program works in background, transparent...addition program saves static text elements and windows edit controls: - Window content of most chat clients...text from clipboard - File operations - System registry operations - Application installation/uninstallation - Putting programs in...
 
espionagetrojaninternetmonitoringcheating spousedetectivekeyloggerhackinginvestigationsecurityaccess controlkey logerparental controlsurveillanceintelligencespy
...is the most remarkable security product for a computer you have seen. Program works in background, transparent...addition program saves static text elements and windows edit controls: - Window content of most chat clients...text from clipboard - File operations - System registry operations - Application installation/uninstallation - Putting programs in...
 
securityinvestigationdetectivehackinginternetcheating spousemonitoringsurveillancekey logerkeyloggertrojanparental controlespionageaccess controlspyintelligence
...is the most remarkable security product for a computer you have seen. Program works in background, transparent...addition program saves static text elements and windows edit controls: - Window content of most chat clients...text from clipboard - File operations - System registry operations - Application installation/uninstallation - Putting programs in...
 
surveillancesecurityintelligencekeyloggertrojanespionagespyaccess controlparental controlinternetinvestigationdetectivemonitoringcheating spousekey logerhacking
...and enjoyable work space. Other features include manually editing or adding of entries, hiding or displaying installed...
 
slowcleanerregistryedit hiveaddremoveadd removeinstaller softwareforce deleteutilitycleanupuninstall programinstaller problems
Reg Organizer

Shareware by ChemTable Software
34 x 4643Kb downloads

Free Vista Files award
...registry, fix errors in the system, and improve computer performance. The deep registry search feature lets you...find all registry keys related to a specific application. The program...helps you to edit registry files (.reg) and view their content directly from...
 
systemregistrytoolorganizeutilitiesreg cleanerorganizer
Free Vista Files award
...Registrar Registry Manager is a complete registry management solution with a wealth of powerful features....for administrators and power users for maintaining the registry on both the desktop as well as remote...network. It offers the benefit of a one-stop registry management solution, a very rich set of tools...It is safer than Regedit, the native Windows registry editor as this software offers registry backup and...
 
backupregistry editorregistry securityregistry managerregistry searchreg filereg searchregedt32reg replaceregeditrestore
Clean It

Shareware by Skylark Utilities
20 x 401Kb downloads

...a punch when it comes to keeping your computer clean without over doing it. Now comes with...machine clean. Clean It Can Help Keep Your Computer Running At Top Speed! This very simple and...The included Plug-Ins even clean out the system`s registry which provides you even more drive space, more...
 
wipeeliminateskylarkclean-itshredscrubcachedeleteeraserinternetprovinceprivacycleanit
nnCron

Shareware by nnSoft
14 x 877Kb downloads

...and reminders, - shut down and hibernate the computer or put it into sleep mode at a...specified time, - "wake up" the computer in order to run a task, - display/hide/close/kill/minimize/maximize...shell which can be used to remove, add, edit and run tasks, set up reminders, change program...
 
forth languagesoundfile existhotkeyregexcrontabautomationclipboard monitorautomation managerremote administrationwinspyreminderwindow existfile monitorschedulermacroscripting
Magic Utilities

Shareware by EFREESKY SOFTWARE
20 x 1733Kb downloads

Free Vista Files award
...is a cute program designed to make your computer clean and more stable. These utilities include Uninstaller...Automatically detect the bad entries left behind in registry by misbehaved uninstallers. Full control all program`s unistall...
 
processremoveuninstallerstartupadd
All In One Computer Tools

Shareware by Tools4PC
12 x 2335Kb downloads

...softwares, you can just install All In One Computer Tools which: Completely removes sensitive data from your...on Startup The Startup Manager will let view,delete, edit and add startup entries. The Startup Manager can...Auto shutdown Automatically Shutdown, Reboot,or Log off the computer at schedule time you specify. Registry Enhancement:Change Windows...default settings, without you need to edit the registry. Setting group of window you can...
 
managementinternet passprivacyspywareoutlook passwordsstartup managerwipeshredrecover web passwordenhancementhotkeyshide group windowstopmost group windowsauto shutdowntweaksblock group windowsadwaretracksvirtual desktopencrypt
StartEd Lite

Freeware by Outertech
6 x 2717Kb downloads

...Horses, the most destructive and dangerous species of computer viruses. It allows you to backup and restore...
 
startup configurationautostartsystem settingssystem maintenanceregistrystartup foldersystem servicestrojan horses
...Run the profile with a single mouse click. Edit the File/Open dialog of Windows and MS Office...address and visa versa Enable Windows XP Home Edition to join a domain Tweaki`s Undo feature lets...only can you apply Tweaki`s features to the computer Tweaki is installed upon -you can also apply...them to any computer on a network. You can even apply changes...to multiple computers at once. No need to install software on...
 
system2000securityinternetpowerdesktoptweakiexplorermanageconfigurejermarregistrywindowsshell
...space and improving performance. Scan, clean, and repair registry problems. Computer-Expert Supervisors Pack contains 3 tools: -...viruses, and improve your system performance. - Advanced Registry Supervisor - scan your Registry for possible problems...
 
historybackupcleanrepairoptimizeregistrystartup
System X Guard

Demo by ASD Group Software
13 x 1476Kb downloads

...run automatically on startup. You can disable entries, edit entries, locate entries in the registry, create new...allows to speed-up Windows boot time and increase computer performance by disabling useless programs. It makes it...
 
securitysxguardspeed load windowsantivirussystem cleanerresume processcontrol processstartupsmonitoringcontrol regeditsuspendprotecting your systemadvanced task managersystem guardview process
Registry Rinse

Demo by SecureLink
13 x 1Kb downloads

...software. It will safely clean and repair Windows Registry problems with a few clicks and enable you...enjoy a cleaner and more efficient PC. The Registry is the nerve center of your PC, and...problems with the Windows Registry are a common cause of Windows crashes and...
 
registry tweaksrestore windows registryregistry fixwindows registry erroredit computer registryregistry windowsregistry cleanerregistry key cleaner
...1 Click Fixer PLUS is the most advanced registry cleaner utility on the market. That allows complex...cleaning of windows registry in an easy, safe and reliable way. With...complex tasks such as automatic repairing of Windows registry problems in just 1 simple Click? It can’t...get easier then this. Problems with the Windows registry are a common cause of Windows crashes and...performance.
 
registry fixerspeedfix registry errorscleanup registryerror freeregistry cleanersregistry editorfree repairproblemswindow utilityperformancetroubleshooting computer
Autorunman

Shareware by Rudenko Software
8 x 615Kb downloads

...found. In addition Autorunman allows the user to edit startup properties for each application, including it`s window...
 
startupwindowsmanagerautorunregistry