1 2 3 4 5 6 7 8 9 ... 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Public Reminder Add-In

Shareware by SDMD GmbH
2 x 1759Kb downloads

...PST file, or Public Folders. Reminders can be emailed to any pager or email enabled communications device...Try Public Reminder Add-In for Outlook. You can filter your reminders, you can select in a „field...
 
calendar reminders2007microsoftwinreminderoutlookexchangecontactstask reminderofficegroup calendarpersonal remindersexchange remindersoutlook 2010group remindersaddresstask remindersoutlook reminders
4Easysoft ePub to iPhone 4G Transfer

Shareware by 4Easysoft Studio
2 x 6113Kb downloads

...ePub to iPhone 4G Transfer, you can easily filter your desired ePub file by the category of...
 
epubexport epub from iphoneepub iphone transferoutput epub files
AVCWare iPod to iPod/PC/iTunes Transfer

Shareware by avcware.com
3 x 5732Kb downloads

...conveniently. 4. Find what you want quickly by Filter and Quick Search tools. 5. The information about...
 
ipod computer transferipod itunes transfersoftwareipod ipod transfer
ShareZilla

Freeware by ShareZillas
4 x 4528Kb downloads

...ebook, author etc) and even select a specific filter to your searching (advanced metasearch) and you`ll be...
 
peer-to-peer clientp2p clientgnutellap2p softwarebittorrent clientsharezillafile sharing applicationfree music downloadsfile sharing softwarefile sharing program
iPixSoft Video Slideshow Maker

Shareware by iPixSoft Studio
9 x 23887Kb downloads

...such as brightness, contrast,corp, etc. * Apply various filter effects to photos * Add muti audio files...
 
video slideshowslideshow softwareadobe flash playerflash slideshow makerphoto slideshow
...easily. 12. Find what you want quickly using filter or quick search function. 13. View iPod files...
 
ipod backupipod movie transferipod manageripod ripipod softwaredvd ipod transferipod music transfer
DiskFonts font viewer and manager

Demo by Anastasiy Plugins
14 x 1873Kb downloads

...font manager inside Adobe Creative Suite software (PS/AI/ID/etc). Filter several fonts from hundreds with one click. Compare...
 
illustratordesignfont browsercompare fontsphotoshopindesignpluginfont viewerscript fonttypographyhelveticadesktop publishingopen typecalligraphydreamweaverfont managergraphichtml5true type
IP-COUNTRY-CITY-WEATHER Database

Data Only by IP2Location.com
4 x 200Kb downloads

...advertisement campaign by region; 9. Spam filtering; 10. Filter access from countries you do not do business...
 
latitude longitudecountry citytime zoneweather codelocationnetspeedzip codeispgeolocationaddressweb visitor
Blade API Monitor

Shareware by Blade API Monitor
3 x 2364Kb downloads

...and ANSI application; Support multi-thread; Presets 27 API Filter Profiles, including Handles and Objects, Dynamic-Link Libraries, Event...
 
api tracetrace apiapi monitorwin32 api spyspy apyapispymointor apiapimonitorexewin32 api monitorapi tracermonitor api calls
Leo Backup

Shareware by S5 Development
2 x 3273Kb downloads

...Leo Backup is a program designed for Windows and intended for backing up your data in various locations, including secure servers (SFTP and FTP/SSL) and network drives. Effective file...
 
scheduled backupfilteractive directoryservice modeftpsslencryptionsecurityreportingprivate keyremote backupsecure backuprestoreserverspublic keysftpaccessprotectioncompressionsecure ftpauthorization
IP2Location IP-COUNTRY-REGION-CITY-LATITUDE-LONGITUDE-ZIPCODE-TIMEZONE-ISP-DOMAIN-NETSPEED Database

Data Only by IP2Location.com
5 x 200Kb downloads

...advertisement campaign by region; 9. Spam filtering; 10. Filter access from countries you do not do business...
 
web visitoraddresstime zonezip codedomain namenetspeedcitygeolocationisplatitude longitudecountry city
IP2Location IP-IDDCODE-AREACODE Database

Data Only by IP2Location.com
3 x 200Kb downloads

...advertisement campaign by region; 9. Spam filtering; 10. Filter access from countries you do not do business...
 
isparea codezip codecitylatitude longitudedomain nameidd codetime zonegeolocation
Video Codec Scoring System ViCoS

Demo by YUVsoft Corp.
8 x 7007Kb downloads

...interface and functions for video codec or video filter analysis with results visualization. The main purposes of...
 
video codech264ssimmoviestestingcomparisonquality estimationmetricvp8psnr
Chatroulette

Freeware by Chatroulette RVC
11 x 273Kb downloads

...The top rated Chatroulette Script Chatroulette RVC is the highest rated and most popular script to start your own chatroulette website. Watch our demo and remember: you can change layout,...
 
chatroulette
Zillya! Internet Security

Shareware by ALLIT Service LLC.
7 x 92679Kb downloads

...and prevents viruses and other malware - Mail filter checks all incoming and outgoing mail messages for...
 
adwareantivirusmacro virusweb-filterquarantinefirewallfree virus scanningcure virusesheuristicmalwaremail scanzillya internet securitytrojanspyware
Counter of Visitors-7

Freeware by Style-7
2 x 20Kb downloads

...format by total or per day. Scripts have filter for robots and use text file for store...
 
counterphp
PrivateEye

Demo by Oculis Labs Inc
3 x 15339Kb downloads

...options have been limited to clumsy plastic privacy filters that do not work. PrivateEye reacts to you,...
 
privacy filterwebcamsoxgaze trackingsciclassifiedspyingeavesdroppingscifsecrettsscishoulder surfingsarbanes-oxleylaptoptop secretsecurityface recognitionprivatehipaaprivacy screenface tracking
VirusBuster Professional 64-bit

Commercial by VirusBuster Ltd.
2 x 54687Kb downloads

...desired settings. VirusBuster Professional`s resident protection and content filter contain pre-defined protection levels, from which the user...
 
anti-malwareantivirus
VirusBuster Internet Security Suite

Commercial by VirusBuster Ltd.
3 x 54687Kb downloads

...With its anti-malware, anti-spyware, safe browsing, spam filter features and two-way firewall, the VirusBuster Internet Security...
 
anti-malwareantivirusanti-spywaresafe browsingspam filterfirewall
VirusBuster I. Security Suite 64-bit

Commercial by VirusBuster Ltd.
2 x 54687Kb downloads

...With its anti-malware, anti-spyware, safe browsing, spam filter features and two-way firewall, the VirusBuster Internet Security...
 
anti-malwareanti-spywarespam filterantivirussafe browsingfirewall