Sort by : ReleasedNameDownloadsAddedRatingRelevance
Claymore Card Filer

Freeware by Blink Development
70 x 5033Kb downloads

...various useful bits of information. Even though this software is free, it is well supported. There is...
card filercontact databasepim
Remote Control PRO

Shareware by Alchemy Lab
85 x 1910Kb downloads

Free Vista Files award
...Complete and efficient remote control solution that gives you full control over remote computer as if you were working directly at it - viewing/controlling remote desktop, running windows and console...
remote control softwareremote shutdownterminal serverremote accessremote administratorremote desktop
Free Hex Editor

Freeware by HHD Software
487 x 2072Kb downloads

...Free Hex Editor Software - Binary and Hex file editing tool for...
codesoftwarefreeviewerwindowsreadertextdumpsfreewarehex dumpfileeditingbinhexeditor
ViPNet Password Roulette

Freeware by INFOTECS GmbH
56 x 2724Kb downloads

...We have been working for decades on the software security market and have often met the, INFOTECS released an absolutely free of charge software password generator, which generates random passwords so that...can be memorized easily. The innovation of this software is simple and genius. The passwords are derived...
free password generatorpronouncable passwordpassworterzeugerfree random passwordvortexpasswrternpassword roulettefreeware password generatordiplodock
Media Catalog Studio Lite

Freeware by ManiacTools
177 x 2926Kb downloads

Free Vista Files award
...this problem with Media Catalog Studio, a handy software application for classifying and tracking media files. This...
wma tag editorcollection managervideo managerid3 tag editoroggmovies organizeraudiomp3 taggervideo organizermusic organizerwmvcddbmpegmedia organizerpalylist managermp3 organizermp3 managerape
Hide & Protect any Drives

Shareware by IM-Soft
145 x 952Kb downloads

Free Vista Files award
...drives with "Hide & Protect Drives". Stop unauthorized software installations and data leak by removable media....
restrictrestrictingrestrictionslocksecurityaccesscontrolhard drivedvdcomputerpasswordprivacyfreeprotect
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
250 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made that?" Consider the...
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
smc WebStore Free

Freeware by smc technologies, Inc
88 x 4146Kb downloads

...and sell your products online with a FREE ecommerce solution. Designed to be easy to use easy shoppers experience. Features include: 100% free ecommerce system. No hidden charges, no advertisements, no contracts, hosting plans or software to buy. Sell up to 10 products from...
e-commerceecommercestorefrontshopping cartsshopping cart programsebusiness softwareshopping cart softwareeasy shopping carte-business softwareshopping cart systems
Amazing CD & DVD Burner

Freeware by NPS Software
524 x 778Kb downloads

...Easily burn music, video and data CDs and DVDs. Amazing CD & DVD Burner handles all drive types including CD-R, CD-RW, DVD-R, DVD+R, DVD-RW, DVD+RW,...
dvd copyfree dvd burner downloadsdvd burnersfree mp3 dvd burnerfree dvd burner programsfree dvd burner softwarecopy videocopy dvdamazing
SecureCentral PatchQuest Free Edition

Freeware by AdventNet Inc.
77 x 30666Kb downloads

...SecureCentralâ„¢ PatchQuest is an automated web-based patch management software for distributing and managing patches and service efficiently scans your enterprise network, identifies missing software patches, distributes them to vulnerable systems and keeps...
linux patch managementmicrosoft security patchesmicrosoft patch managementpatch management softwarewindows patch managementsecurity patch managementhotfix management
DipTrace Free

Freeware by Novarm, Ltd.
82 x 95857Kb downloads

...DipTrace is an advanced PCB design software application that consists of 4 modules: PCB Layout...libraries. Besides being very simple to learn, this software has a very intuitive user interface and many...
pcb softwareelectronicsschematic captureecadpcb layoutpcb design software
.::Anonymous Guest - Proxy Checker, SOCKS Manager::.

Freeware by SPS-Group
144 x 7034Kb downloads

...Anonymous Guest is the software, that gives a full spectrum of opportunities to work with proxy servers. It allows you to be connected to the Internet and work with the...
...CatalogBuilder is multimedia CD brochure making software for both business as well personal album. A...brochure or electronic catalog. Unlike most photo album software or photo gallery creators, CatalogBuilder gives typical edge...
free slide show builderfree catalog builderfree catalog softwarefree photo album softwarefree web catalog makerfree catalog maker
...Vevo! CatalogMaker is simple to use, yet powerful software to facilitate catalog making (both printed catalog and...catalogs and PDF catalogs. Unlike most Digital cataloging software or Catalog Making Solutions, since it uses MS...
catalog makermarketing softwarepowerpoint albumdigital catalogcatalogingalbum makercatalog softwarecatalog builderpresentation maker
...Vevo! eSales is comprehensive emarketing software to facilitate both digital catalog and digital marketing....successful catalog driven business. Unlike most Digital cataloging software or Digital Marketing Solutions, it focuses on critical...
digital marketingdigital catalogemail campaignssales presentationscatalog presentationsemarketing

Shareware by
118 x 9894Kb downloads

Free Vista Files award
...InventoryBuilder is a powerful, easy-to-use inventory manager designed to help you organize your valuables and important documents. In case your house is damaged or burglarized you can print...
home inventoryinventory management systemsinventory softwareinventory programs
NotePager 32

Freeware by NotePage, Inc.
128 x 2017Kb downloads

Free Vista Files award one of the leading wireless / SMS software applications for small businesses and home users. Text...
mobilephonepaging softwaresms messagenextelmessagingalphanumeric softwarecommunicationcommunicatewirelessdispatchpcspagerspager softwaresend smstext messasms software
Nice PDF Compressor

Demo by NicePDF Software Inc.
312 x 1471Kb downloads

...of the smallest size. Another benefit of this software utility is batch conversion; you can compress all...
freewarecompactshrinkerreducecompressdocumentsmallsizecompressorcompressionpdffilesmaller PDF Version Converter is the answer. This software utility enables you to convert PDF files between...
Alien IP

Shareware by ArmCode
83 x 16931Kb downloads

...Alien IP is trace routing software that resolves domain names, pings IP addresses, and...