1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Download Accelerator Plus

Freeware by Speedbit LTD.
494 x 2133Kb downloads

Free Vista Files award
...(DAP) 10, the world`s fastest and most popular Download Manager and Accelerator, has been installed over 300...million times. DAP accelerates your downloads to the fastest possible speed. DAP provides file...management tools that allow you to download efficiently and save time. DAP`s patented, award winning,...multi-channel technology empowers you to download videos, applications, photos and music files with a...level of speed and efficiency.
 
optimizeacceleratorstreamingdownload accelerator plusdownloaderdapinternetorbitfreesecurespeedbitfacebook downloaderfastweb acceleratorconverteridmvideo downloadprivacygetrightdownload manager
Xilisoft iPhone Magic Platinum

Shareware by xilisoft.com
3 x 49638Kb downloads

...convert DVD movie, common video and audio files, download exciting online videos, extract audios to make personalized...iPhone without troubles by DVD encryption. 6.One-step to download and convert online videos from top online video...built-in resizable media player to preview DVD movies, videos and photos and snap screenshots as wish in...previewing videos or DVD movies. 12.Automatically select the optimized profiles...
 
iphone manageriphone transfertransfer iphoneiphone backup
GetGo Download Manager

Freeware by GetGo Software Ltd.
670 x 5829Kb downloads

...Free Complete Online Video, Music and File Download Manager with YouTube Download Support. This Free Downloader...is an Essential Internet Tool for Increasing Download Speed, Resuming, Scheduling, and Organizing Downloads. Easy to...use, customizable modern interface allows you to download all of your favorite videos, program, games, and...never have to waste your frustrations on unfinished downloads due to network problems, or...
 
video downloaderfree download manageryoutubeyoutube downloaderfacebookvimeodailymotiongetgointernet download managerbreakflvmegavideovideo download manageryoutube download managerdownload acceleratorspikemetacafe
...portals at once or in selected portals, view videos directly and convert and save them to your...Nothing makes finding, viewing, saving and managing web videos easier. And Ashampoo ClipFinder HD isn`t just better,...it`s cool. Enjoy videos on the revolutionary 3D Video Wall, download and...convert videos with only one click, play your favorite videos...
 
youtubeveohvideo playermyspacecomyahoo videogoogle videovideuvimeovideo sevenloadvideo viewerdailymotionmp3 downloadspikemetacafeclipfishlivevideoashampoo clipfindervideo search
Ultraget Video Downloader

Freeware by ANVSOFT Inc.
73 x 1838Kb downloads

Free Vista Files award
...Ultraget Video Downloader is a free online video downloader, which can...easily and swiftly download any online videos, movies, TV shows, music videos...even aged-restricted videos from 1,000+ sites, like YouTube, Break, Facebook, Veoh,...Liveleak, Movieclips, Photobucket, Nicovideo, Vevo, MTV, Hulu, Blockbuster, Dailymotion and any other similar feed sites. With this...
 
download vevomusic download freedownload vimeodownload huludownload videovideo downloaderultraget video downloaderdownload web videoonline video downloaderdownload facebookfree download youtubeyoutube mp3
...Audio Converter is designed for extracting audio from videos and converting audio between popular formats, such as...you add and convert any unprotected audios and videos to WAV, WMA, OGG, AAC, MP3, M4A, MP2,...also a free online video downloader, which can download videos from YouTube, Facebook,Vevo,Veoh, Break, Dailymotion, Vimeo, Myvideo.de,...Nicovideo and so on. And convert these online videos to key audio formats including WAV, WMA, OGG,.
 
mp3 wmaflv mp3video audiomp3 aacwma mp3wav mp3audio converteryoutube downloadermp3 flacmp3 oggwmv mp3youtube mp3 convertermp4 mp3mp3 aiffdvd mp3
Free FLV Converter

Freeware by Koyote Soft
1353 x 398Kb downloads

Free Vista Files award
...Search and download movies from YouTube, DailyMotion, Google for Free! This...StageVu, Spyke, yahoo, veoh, Crackle, Megavideo, Blip, MyVideo... videos without opening your browser and you can even...watch the videos using the built-in video player. Free FLV Converter...save desired video. This software can convert the videos to Avi, Ipod, iphone and psp format (MPEG4...H.264).
 
pspdailymotionconvertflvconverteripodmpeg4h264iphoneyoutube3g2
E.M. Youtube Video Download Tool

Shareware by EffectMatrix Inc.
48 x 6924Kb downloads

Free Vista Files award
...E.M. Youtube Video Download Tool can download, Convert, manage, burn, Search, repair...online video; Main Features of E.M. Youtube Video Download Tool: Download high quality video(like mp4, mov,); Download...to CD/VCD/SVCD/DVD disc; (How to Burn?) Search flv videos on many websites at the same time; Convert...FLV videos to any videos or audios(MP4, Avi, Xvid, Divx, PSP, Wmv, Mov,...
 
youtube iphoneflv aviflv downloadyoutube converterdownload youtubeconvert youtube videoyoutube downloaderflv ipodburn youtube video
BPS Youtube Google Video Grabber

Freeware by Bullet Proof Soft
216 x 2757Kb downloads

...Grabber is an easy to use program to download video files from google, youtube, ifilm and other...sites. You can download using grab and keep flash movies or videos...video from the (12) supported sites to the download page. Then you can start downloading the list.YG...Video Grabber has the capability of batch downloading multiple video streams from multiple video sharing sites...
 
putfilegrabbermyspacebreakvideo linkgoogle videozippyvideoesdownload listdailymotionifilmyoutubeboltipodangryalienthatvideositewebvideobliptv
Movavi Flash Converter

Shareware by MOVAVI
14 x 18634Kb downloads

...Movavi Flash Converter - the ideal tool for downloading video from YouTube, Google and other popular video-sharing...websites and converting Flash (.flv) videos to any format for any device. With Movavi...save whole collections of your favorite viral Flash videos and convert them to the best format for...burning to DVDs! Key Features: - Download Flash video from YouTube and other popular video-sharing...websites.
 
download from youtubedownload from videogoogleconvert flash videodownload from metacafesave video from youtubedownload flash videodownload flv video
save2pc Pro

Shareware by FDRLab, Inc.
109 x 2951Kb downloads

...Downloads videos from Youtube, Dailymotion, Tangle, Google, Break.com, TeacherTube, RedTube,...Laptop, iPad, iPhone, PDA, Pocket PC, Mobile phone. Download High Quality videos and High Definition videos from....wav, .mp3. No extra codecs or players needed. Download several files at the same time. Preview selected...size, length, rating, views of a file before downloading it! Download videos from adult video servers. Video.
 
mobilevideompegpspipodgooglegrabcatchhuluiphoneyoutube
...you require for your device. Even better, it downloads flash videos from platforms like Youtube and MyVideo...Internet-platforms as source of conversion - Direct video download from portals like Youtube, Google Video, Clipfish, MyVideo,...VideoTube, MySpace, Metacafe, Sevenload, iFilm, blip.tv and dailymotion possible – with or without conversion - Integrated...what you want to see - Splitting of videos for memory card players or other devices with...
 
video-toolsmultimediavideo converter
...PQ Youtube Downloader Pro can help you detect and download online...play full-length movies instantly as soon as the download starts. Download 5 to 8 times faster. Convert...your downloaded movies, videos, music videos to iPod, iPhone, PSP and watch them on...the road (Need PQ FLV Downloader PRO). Features: *Powerful Video Capture & Download Features...simply works out of the box.
 
ebaums worlddownload metacafeaol videomyspaceailymotionyahoovideodownload youtube videos ipodstupidvideosyoutube downloader propeekvid
Moyea YouTube Downloader

Freeware by Moyea Software
39 x 7812Kb downloads

...Moyea YouTube Downloader is freeware to download online youtube videos and FLV videos with fast...speed. You can enjoy the free videos with the free downloader. Have you ever find...it difficult to download videos from websites like YouTube.com and Google Video? How...to get the videos so that you can enjoy them offline? Moyea...YouTube Downloader is a great tool for you to make...your thoughts come true.
 
moyea youtube downloaderdownload youtube videofree youtube downloader
E.M. Free Youtube Download Tool

Freeware by EffectMatrix Inc.
18 x 5783Kb downloads

...E.M. Free Youtube Download Tool is a powerful tool that can download...video files. Main Features of E.M. Free Youtube Download Tool: * E.M. Youtube Video Download Tool allows...you to download videos to your computer automatically, when playing the video...webpages or entering the video URL. You can download from:YouTube,Google Video, Break, Metacafe, MySpace, Vimeo, vSocial, iFilm,...
 
download youtubesnif flvsearch videortmp streeam captureflv downloadfree download youtube videoyoutube downloadsearch flv video
YouTube Downloader Suite

Shareware by Apowersoft
239 x 24697Kb downloads

...YouTube Downloader Suite gives you the ability to download your favorite YouTube videos to play locally on...PC and convert the downloaded videos to other video or audio formats like AVI,...the ability to crop, trim and subtitle YouTube videos to retain your wanted video parts. In addition...YouTube video downloader, you will be allowed to download videos from Google video, MySpace TV, Metacafe, Dailymotion,...
 
capture video from youtubeyoutube video converteryoutube video downloaderdownload free youtube videosdownload video from youtubedownload youtube movies
...for you to search, browse, download, and convert videos from video-sharing web sites such as YouTube, Yahoo...video, Google video, MetaCafe, DailyMotion, PhotoBucket, RedTube, XVideos and more. With Tube Explorer`s unique built-in video...you can quickly and efficiently search and browse videos from all of the popular video sites. With...list for easily browsing. Simply gather your favorite videos from all of your favorite sites, and watch...
 
download youporn videodownload xvideos videosdownload youtube videodownload redtube videosdownload yahoo videodownload google video
...device or for your demands. Even better, it downloads without further ado flash videos from platforms like...Internet platforms as conversion source - Direct video download from portals like Youtube, Google Video, Clipfish, MyVideo,...VideoTube, MySpace, Metacafe, Sevenload, iFilm, blip.tv and dailymotion – with or without subsequent conversion - Support...
 
konvertermultimediaaudio
Bulk Image Downloader

Shareware by Antibody Software
46 x 5726Kb downloads

...Bulk Image Downloader automatically downloads and saves images and videos from thumbnailed web...right click context menu for even easier downloading. Download thumbnail gallery images interactively or send them to...the Queue Manager and have them all downloaded automatically one gallery at a time. Images that...fail to download within a batch are automatically saved to new...others too list here.
 
thumbnaildownloaderpicturemetacafeflickr downloaderpornhubgalleryimagevenuefuskeryoupornyoutubemegapornimagefapmegavideodeviantarttube8dailymotionredtube
Video Download Studio

Shareware by aHisoft
31 x 27566Kb downloads

...Online Video Downloader / Total Video Converter / Powerful Media Player...[Video Download Studio] is a powerful video downloader and converter tool which can help you download...iFilm etc, it also helps you convert online videos to all kinds of video and audio formats...complicated video and movie formats. Features Highlight: 1. Download online flv streaming videos Support most popular web...Etc. 4.
 
download videosdownload veohdownload imeemdownload revverdownload breakcomdownload dailymotiondownload vreeldownload bliptvdownload youtube videosvideo downloadsvideo downloaderdownload free music