1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Domain Name - Analyzer & Generator

Freeware by HostingDude.com
23 x 506Kb downloads

...Complete Domain Name generator and availability checker software finds you the right...of "tractors.com"). Choose any of 17 Top Level Domains (TLD) extensions to check, such as .com, .net,...hypens in names, and more. Export lists of domain names to text file or MS Access file....powerful WHOIS tool. Once you find the perfect domain name, one click lets you instantly register it...
 
domain namesfindname spinnergenerateregisterdomainscreate
SourceGuardian PHP Encoder

Commercial by SourceGuardian.com
17 x 22425Kb downloads

...Command line encoder available now + Encrypt to domain name + Encrypt to IP + License generator...source files + Deployment options + Lock to domain names, IP addresses or LAN hardware + Timeout...
 
encryptionsecurityphp protectphp encoderobfuscationencrypt phpprotectionscript encodingphp encrypt
Domain Name Checker

Shareware by NetPromoter
16 x 3211Kb downloads

...Domain Name Checker is a feature-packed, convenient and fast domain...checking software that finds attractive domain names for your personal or business Web site and...them. It includes an ultimate registrants` database, integrated Domain Name Generator, Popularity checker and customizable user interface....You can enter the domain list manually or generate it from keywords. This...
 
search engine optimizationmanage domain registrationdomain name checkdomain name registrationsite optimization
FastRequest HelpDesk

Shareware by FullData inc.
16 x 53882Kb downloads

...can easily create custom forms with the form generator or you can use of included design templates...you have to do is to reserve a domain name. The FastRequest application is used online while...
 
online formcmmshelpdesk onlineweb formwork order onlinecrm helpdeskweb-based helpdeskhelp deskworkorder onlinebiomedical helpdeskonline service request
DomainInspect

Shareware by AntsSoft
17 x 1293Kb downloads

Free Vista Files award
...DomainInspect is a feature-rich domain name checker software, enabling you to quickly and conveniently...find desired domain names to register. The built-in database embraces more than...and ccTLDs. You may choose to manually input domain names, import domain name list in a file,...or have domain names based on keywords automatically generated. DomainInspect simultaneously checks...
 
domain name generatorwhois softwarelink popularity checkerwhois lookupdomain checkerdomain lookupdomain search
Avensen Domain Name Finder

Shareware by Avensen Software
11 x 1894Kb downloads

...Need a good domain name and still searching for one by one? Avensen...Domain Name Finder is a domain name generation and availability check software, capable to lookup...thousands of domain names per minute. Domain names can be generated from keyword groups, entered manually...or imported from a file. Create high quality domain names using the brainstorming technique. Check domain names...
 
brandinternetnamingfindercheckingcheckerwebavailabilitygeneratordomaindnsbrandingsearch
IDwhois

Freeware by IDwhois
14 x 552Kb downloads

...system that lets you retrieve registration information for domain names. IDwhois is using the whois TCP-based query/response...in order to determine the owner of a domain name, an IP address, or an autonomous system....CSV or .XML for fast reporting - Import domain name list from a .TXT file - XML...- WebService Live Update - Proxy environment - Domain names generator based on keywords - Auto-alert on...
 
clientwhois

Freeware by Despeus
15 x 303Kb downloads

Free Vista Files award
...Nick Names and Domain Names and Company and Brand Generator and Domain Name...
 
generatorfirmproductnickdomainchecker
...like Time, Daytime, Echo Plus, Email Verify, Finger, Name Scan, Ping Scan, Port Scan, Service Scan, Character...when diagnosing Internet and Intranet problems. Our advanced domain search allows you to search ALL top level...web sites, if available, and links to the domain registrar. In addition, NetGadgets provides Local Information Network...
 
recorddnsinformationpingportfingername scanwhois
DomainKing

Shareware by twotails.biz
12 x 1011Kb downloads

Free Vista Files award
...DomainKing is a WHOIS domain name checker which can find free, taken and expired...domain names on over 100 domain extensions. Among it`s useful features is also the...ability to generate domains based on keywords, search the web for domains,...generate misspelled domains and extract domains from fileformats used by Pool.com and Snapnames.com. DomainKing...
 
whois searcherdomain creatorcctldsearch whoisexpired domain namegtldlookupdomain checkerfind domain namesdomain name whoisdomain generatordomain finderfind domainsdomain name checkerdomain name finder
Ruby Encoder

Commercial by RubyEncoder.com
6 x 3500Kb downloads

...clients + Command line encoder + Encrypt to domain name + Encrypt to IP + License generator...for encoded scripts + Lock to domain names, IP addresses + Timeout your scripts at...
 
ruby encoderencryptionencrypt rubyprotectionobfuscationsecurityruby encryptruby protectscript encoding
Password Control

Freeware by WiseSoft
11 x 1248Kb downloads

...Modify to ensure all user accounts in your domain have a common-name that conforms to the company...policy that the common name should be set as "LastName, FirstName". You can...
 
adsildapaccount managementmodify attributesadmodifybulk modifyupdate attributesuser managementsystem adminactive directory usersbulk updatehelpdeskwisesoftpassword reset
NameCombo

Freeware by Raindance Media
9 x 424Kb downloads

...Domain name search tool to find available domain names using hundreds of topical word lists and/or your...own keywords to create thousands of domain name combinations. With just a few clicks find avaiable...domain names and register domain names easily. NameCombo shows you available domain names with our unique...
 
free domain name searchdomain names availabledomain name lookupavailable domain namesdomain name saerch enginedomain name generatorcompany name free generatorcompany name generatorfree company name generator
...for? You receive about 2000 variants of the domain names. This tool of 100% will help you...and your imagination to find the name for the new domain. How to use this...the Generate button. Look through the list of names and double-click the ones you find most attractive....
 
site name generatordomain name generator
DNSS Domain Name Search Software

Shareware by Nsasoft US LLC
3 x 1964Kb downloads

...DNSS Domain Name Search Software is the easiest to use toolkit...on the market for finding great web site domain names. The software checks hundreds and thousands of...potential domain names for your business and allows to find great...domain names that you would not normally have thought of....DNSS Domain Name Search Software includes an in-built popular search keywords...
 
domain search softwarefind domain namefind available domain namedomain name search
Domain Name Generator Desktop Client

Freeware by AlternaMedia Inc.
3 x 2908Kb downloads

...With millions of domain names already taken, it is hard to find a...catchy domain name that is still available. Domain name generators use advanced algorithms to generate domain names...keywords or random syllables and phonemes. The generated domain names are pronounceable in English and in many...cases easy to remember and fully brandable. This domain name generator uses a wide range of techniques to generate...
 
domain name searchwhois checkwhois desktop clientbulk whois checkdomain generatordomain name generator
Autosurf_Traffic_Exchange

Shareware by ProKt
3 x 1Kb downloads

...paid to read site TODAY! Web hosting and domain name registration. Prokt makes unique run your own...
 
dedicated serversdomain namescgitraffic exchange softwareearn monetraffic exchange scriptget paid surftraffic exchange systemclickreadscriptsperlphpscriptingweb hostingregistrysemi-dedicated hosting
...passwords. You need an appropriate word for your domain name, company, business, pet or you need nickname...or password? Jimpl Word Generator is a simple and useful utilite, which will...help you to do this. Use this generator for creating new words for free....
 
names generatorword generatorpassword generatornicknames generator