Sort by : ReleasedNameDownloadsAddedRatingRelevance
Delete Duplicate Files Fast

Shareware by Ashisoft
7 x 1922Kb downloads

...You may not realize how many duplicate files you have on your computer, after numerous downloads from the Internet, or scattered over your home or corporate network. Duplicate files are...
 
delete duplicate filescheck identical filesbyte-by-byte comparisondupe hunterduplicate file finderduplicate finder
True Image

Shareware by Acronis, LLC
8 x 240Kb downloads

...True Image 2013 by Acronis is a complete, easy-to-use PC backup and recovery solution. It protects your files, documents, photos, and other precious data. It performs full-image...
 
true image 2013acronisbackup softwaretrue image updatetrue image home
GsLantern EASY!

Shareware by K. Hofacker
16 x 1464Kb downloads

...GsLantern EASY! helps to distribute documents in standard formats compatible to any computer system,...
 
archivepostscriptpdffile conversiontiffxlsprinttoofficeasciisnpjpegpngdoctxtppthtmlfile storagefile transformationghostscripttextemaile-mailgslantern easysendtodragdrop
Account&See Professional Invoicing & Accounting

Shareware by Crowley Graphics
19 x 17641Kb downloads

...with multi currency and multi language support. All documents can be saved as a PDF file, and...
 
officeinvoiceinvoicingbillinglabelsoftwarebillsmailaccountingbusiness
Free Picture to PDF

Shareware by Photo to PDF
16 x 1168Kb downloads

...Free picture to PDF software is a simple to use, yet sophisticated tool specifically designed for converting multiple photos into a single Adobe Acrobat PDF file. If you need to...
 
convertutilityadobejpgpdfsgifmakerturnimagephotofaxesinsertconvertercombineaddcreatordocumentsfreejointifffilestransformcreatepicturepngsoftwareacrobatscanimportbmpmultipage
...type, cost, grading authority, grade, etc. *Save photos, documents and attachments alongside each coin - no more...
 
coin softwarecoin price databasecoin excel templatecoin collecting softwarecoin databasecoin price softwarecoin inventory softwarecoin collectioncoin collection softwaregold coin software
Software602 Groupware Server

Shareware by Software602, Inc.
99 x 126464Kb downloads

Free Vista Files award
...used to access email. Create, share, and publish documents online. Access the document storage from a browser,...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
XmlShell - The Ultimate Lightweight XML Editor

Shareware by Softgauge.com
20 x 875Kb downloads

...non-XML files to XML files. 9. Validate XML documents against DTD or XML Schema....
 
xml spycoloredxhtmlxxesyntaxlightweightxml toolsxsltultimatexsl editorschemaxmlwritertreetransformaffordablestylesheetintelli-sensexmlspyxml editorxml notepadxmlmindxmetal
4t Calendar Reminder MP3

Shareware by 4t Niagara Software
11 x 1173Kb downloads

...sending E-mail and opening Web pages and other documents - Any complex condition for repeating events. 4t...
 
wavmp3schedulereminderplannere-mailschedulercalendarorganizetemplateeventalarmwinamporganizer
Durable Copy

Shareware by KutinSoft.com
14 x 6480Kb downloads

Free Vista Files award
...could be read. As a result, damaged text documents as well as other files, archives, movies, and...
 
durableunstablesectorsbaddamagedconnectioncopymovieunreadablebrokenwirelessfiles
...convert it into single PDF file. Join PDF documents in a batch in any sequence and make...
 
softwarebreakcomposeriporganizemultipleconcatenatedocumentcombineunitedividewritermanagebookpdffusefilemergerjoinmixsplitterpageadobetoolsinglerearrangebuildacrobat
A VIP Sales Management Solution

Shareware by VIP Quality Software
11 x 40446Kb downloads

...your sales team`s activities, share your contacts, calendar, documents etc., send messages to your customers and colleagues,...
 
sales managementnetworkgroupwaresales trackingsales notificationsales projectsoftwaresales schedulingteamwaresales employeesales productivitycollaboration
ActiveInsert

Shareware by Icon Shareware
10 x 4244Kb downloads

...you need, and go. No fumbling for source documents to open, text to select and copy, and...
 
applicationhtmltextinsertinginsertionpastingattachaddonenhancementdatafloatingitemsinformationutilitypaste
Pizzicato Professional

Demo by Arpege Music
9 x 48254Kb downloads

...the full music theory course. - Exchange your documents with other software (Finale, Sibelius, Notion, Cubase,...) through...
 
print scorecompose musiceasy compositioncomposition softwareintuitive compositionmusic page layoutmusic notation programmsheet musicwrite scoresmusic software
Paragon Drive Backup Personal

Demo by Paragon Software Group
28 x 26396Kb downloads

...system with all installed and configured applications, valuable documents and files with no reinstallations required. You can...
 
disk upgradedisk imagingdrive imageclone softwarecloning softwareonline backupbackup dvdrestore datanew hard driveundelete fatclone hard diskdata recovery
System Purifier

Shareware by JitBit Software
28 x 1013Kb downloads

...like: IE address box typed URLs eraser, Recent Documents folder eraser, temporary (temp) folders cleaner, internet history...
 
startupcleanerjunkremoverfileseraserdiskshreddertracksmanagerprivacyobsolete
Free Vista Files award
...has been left in the file system! Office documents and digital pictures, ZIP and RAR archives, music...
 
disk data recoveryhard disk data recoveryhard drive recovery softwarehard drive data recoveryrecovery diskntfs disk recoveryhard disk recovery
User Tracker

Demo by LastBit Software
11 x 2421Kb downloads

...User Tracker is suitable and powerful time tracking and monitoring software for individual user to analyze, competently plan and organize usage of your computer; for company manager or system-administrator...
 
track employeesproject time trackmonitoring softwaretime trackingparenteral controlemployee monitoringemployee productivitytrack computer usage
Outlook Contact Capture-AddressGrabber Standard

Shareware by eGrabber Inc
4 x 22016Kb downloads

...captures contact information from email signatures, web sites, documents and transfers them automatically into popular contact managers...
 
outlook contact capturecopy contacts outlookcapture contacts outlookcopy outlook contactstransfer outlook contactsadd contact outlookcontact capture downloadaddress capture software
Fast Link Checker x64 Edition

Shareware by WebTweakTools.com
9 x 11088Kb downloads

...Fast Link Checker is a tool used for searching sites for broken links. It begins checking from the starting page and goes through all pages one by one until it...
 
websitelink checkersearchlinkscheckingfindbrokenlink validatorwebpage link checkerunavailableinvalid