1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging...(XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and real-time...(vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a rich browser-based interface. Access all...used to access email.
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
IDEA! Free Edition

Freeware by SYCON Beratungs GmbH
52 x 5279Kb downloads

...Highly flexible knowledge organizer and collaboration tool for the smallest project to the largest...
 
information managerbusiness organizerorganizationknowledge managementknowledge organizerbusiness toolsdocument managementcollaboration tooloffice toolsdatabasesproject management
Collanos Workplace Windows

Freeware by Collanos Software Inc.
15 x 58649Kb downloads

...and offline. Collanos Workplace base version is free. Collaboration has never been more simple, secure and practical....
 
task managementgroupwarepeer-to-peerp2pfreewarecollaboration softwareproject managementfile sharinginstant messagingsecure messagingteamworkvoipdocument management
M-Files PRO Document Management Software

Commercial by Motive Systems
28 x 76071Kb downloads

Free Vista Files award
...M-FilesĀ® helps you organize, find and track the documents of your business in a centralized manner. Users...see the document vault as a virtual disk drive on their...Explorer - instantly familiar to everyone. * The document repository appears as a virtual disk drive. *...timestamps and comments. EVERYDAY TIME SAVING: * Find documents instantly by typing words in the search box....of file contents and metadata.
 
checkinfile managementversion controlcheck outcheckoutfindingprevious versionsdocument controlm-filesedmsmfilesversion historyvirtual diskdocumentsdocument management softwaresearching
WebAsyst Suite

Commercial by WebAsyst LLC
32 x 2412Kb downloads

...planning and issue tracking, to store and share documents and notes, to deliver content to your customers...resolution. Customizable workflow. Filters. File attachments. Email notifications. DOCUMENT DEPOT: Store and share files online. Create web-based...
 
collaboration applicationcontact managementproject managementdocument managementwebasystissue trackingweb-based softwareworkgroupsgroupwarecustomer management

Demo by Trichys
15 x 7Kb downloads

...WorkZone is an easy-to-use online collaboration software that allows you to share documents and...
 
document sharingcollaboration softwareaspextranet softwareonline collaborationintranet software
...software. Publishing option allows you to dynamically publish document and 2D CAD views....
 
viewercollaborationpublishingautocadcad drawingsredlining toolredlineannotate
Pacestar UML Diagrammer

Commercial by Pacestar Software
21 x 7011Kb downloads

Free Vista Files award
...Creates UML 2.0 diagrams quickly and easily. Develop, document, and communicate your designs in a systematic yet flexible commonly understood notation. Supports activity, class and object, use case, sequence,...
 
activitydesigncaselanguageclasssequenceobjectcollaborationuml2unifiedpackagestateusecasemodelingcomponentchartdeploymentdraworiented
CTCnet

Demo by Com-Tec-Co S.A.
29 x 76171Kb downloads

...CTCnet is a collaboration and knowledge management software tool. Available to users...through a standard web-browser, it provides comprehensive project, document and process management functionality, combined with version control...built-in Workflow System. Use workflow system to manage document and process flow. Use workflow to facilitate ISO9000...
 
intranetproject managementbug trackingdocument managementknowledgeworkflowextranetiso9000web
SEES

Shareware by Eastbow Lab
19 x 775Kb downloads

Free Vista Files award
...SEES is a concurrent file collaboration and version system provides file sharing, editing by...
 
document collaborationfile sharingseescvsfile collaborationdocument sharing
Kerika

Demo by Kerika, Inc.
23 x 12582Kb downloads

Free Vista Files award
...for team collaboration, with support for process templates, document management and sharing of large files. Kerika connects...content or process flows across multiple projects. The document management features are easy to use, yet powerful:...
 
idea managementgraphical wikiproject managementinternet toolspeer-to-peerproductivity toolsfile sharingcollaborationalternative emailbrainstormingdistributed teams
...to share --- export it to a independent document and share with others easily. Learn more It`s...web-friendly --- the exported document can be uploaded to a web server and...
 
organizerpersonal informationcollaborationmacmanagement
Syncura

Shareware by Syncura
28 x 1969Kb downloads

...Syncura is a team solution for document collaboration designed to save you time. Syncura makes document...sharing and collaboration as simple as saving a file to a...
 
share files with teamvpnsynchronize folderssecure file sharingsync pcsvirtual teamssynchronize filesautomatic backupfile backupsync computersdocument collaborationfile sharing workspacesyncurashare documents
emagiC CMS.Net

Commercial by Emagine
30 x 6347Kb downloads

...as wysiwyg editor, dynamic menu, rotator, image gallery, document gallery, mailForm, external feed, search, newsletter, active directory....
 
free versioncontent managementportalxformssite managementcms
QuickCRC Windows

Demo by Excel Software
23 x 6118Kb downloads

Free Vista Files award
...cards. CRC cards are used to discover and document classes, responsibilities, attributes and collaborations between classes. Design...
 
softwarecollaborationresponsibility driven designprogrammingumlmodelingdevelopmentcrc card
VeryPDF PCL Converter (PCL to PDF)

Shareware by VeryPDF.com Inc
31 x 5565Kb downloads

...Convert LaserJet PCL and PXL to PDF (Portable Document Format), PCL to PDF, PXL to PDF. 3....PCL print files to industry standard PDF (Portable Document Format), PDF documents can be viewed and printed...PXL, PX3) into raster image files and vector documents (PDF, TIF, TIFF, JPG, JPEG, BMP, PCX, PXL)...It is convenient and easy to operate, and documents can be directly dragged from Windows Explorer and...
 
hpgl2hpgl viewerpcl postscripthpgl markupconvert pcl pdfprint prevtiff viewerredline collaborationplot previewhpgl-2pcl texthp-glconvert pcl tiffpcl viewer
LiveProject Project Collaboration

Shareware by KaDonk, Inc.
20 x 29656Kb downloads

Free Vista Files award
...you to enjoy the benefit of real-time project collaboration today. With so many moving people and parts,...you need a collaboration solution that lets you view and manage what...interact with your project for true collaboration. LiveProject Collaboration Core Features: - Ability for you and your...not needed to view your project files. - Document version control for share files. - Easily print...which are then approved by you.
 
project managementmpxmppproject plankadonkproject collaborationproject serverprojctdashboardproject viewermicrosoft projectoffice project serverproject scheduleliveprojectprject
A VIP Sales Management Solution

Shareware by VIP Quality Software
34 x 40446Kb downloads

...combines functions of CRM, Team Organizer, Project Manager, Document Manager. It allows your team to plan, track...your sales team`s activities, share your contacts, calendar, documents etc., send messages to your customers and colleagues,...
 
sales schedulingsales trackingsales managementcollaborationgroupwaresales productivitynetworksales notificationsales employeesales projectsoftwareteamware
A VIP Project Tracking Solution

Shareware by VIP Quality Software
31 x 40446Kb downloads

...successful project results. Solutions - Task Tracking - Document Tracking - Task Planning - Time Planning -...- Project Management - Schedule Management - Team Collaboration - Workflow Automation - Employee Tracking - Workload...
 
time tracking softwareproject tracking softwaredocument tracking softwaretask tracking software
...to engineer sound databases. Comprehensive model management and collaboration capabilities simplify building and maintaining complex enterprise data...models. Collaboration across teams is further enhanced with metadata interchange...
 
data modelingentity relationshipdatabase modeling