1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...DNS MX Wizard is an ActiveX control that lets you query a Domain Name...server. The control automatically detects the local machines DNS server and also allows you to set your...own DNS server to use for the lookup. This control...works with any ActiveX container. It even works in ActiveX scriptable languages...
 
domainexchangeemailsystemrecordsdnsserver
...Content Filter Web Proxy Server has an intelligent DNS cache, an extremely manageable content CACHE system, and...
 
blacklistproxy serverblock accessparental controlinternet gatewayauthenticationweb filtercachenetwork securityinternet securityaccess controlcontent filterantivirusfreeinternet filterfirewallsoftware
...ActiveSocket is a Network Communications ActiveX Control. Features: DNS, HTTP, HTTPs, ICMP Ping, NTP,...
 
winsockipxvbscripttelnetasprshudptoolstcpvbnetsocketsnmpspxtoolkit
Magneto Software Internet Controls Pack

Shareware by Magneto Software
15 x 6375Kb downloads

...Software Internet Controls Pack contains our state-of-the-art Internet ActiveX controls: SkDNS (DNS Lookup), SkFinger (Finger), SkICMP (Ping...Time), SkSystemInfo (System Information), TFTP, and SkWHOIS (WHOIS) ActiveX controls. All of these controls are asynchronous controls...
 
tftp ocxping controltraceroute controlping activexport scan activexport scannerdns activextraceroute activextftp activexdns controlwhois controlwhois activextftp control
SkDNS ActiveX Control

Shareware by Magneto Software
9 x 3535Kb downloads

...SkDNS ActiveX Control is a DNS (Domain Name Service) ActiveX control that can be...network diagnosing, troubleshooting, and monitoring. The Magneto Software DNS (Domain Name Service) ActiveX Control (SkDNS.OCX) allows developers...to integrate the DNS protocol message sending capability into their applications. It...environment, including Visual Basic, Visual C++, and Delphi. SkDNS ActiveX Control is compliant with RFC 1034 and RFC...
 
dns ocxnsapptrminfonslookup ocx1035afxrdns activex1034nslookup activexnullwkshinfoisdndns controltxtcnamex25transferafsdbsigrfczonesoa
Free Vista Files award
...EAGetMail enables your ActiveX, C#, VB.NET, JScript.NET, ASP.NET or other .NET framework applications to parse and receive email based on POP3/IMAP4 protocol. Many advanced features are...
 
ipv6cemailtcpipactivexsmtpmimesmtp ocxtlssecureemailarchitectimap4outlookadminsystemcomponentdllesmtppopdns lookupsendssllibrary
Free Vista Files award
...recipient; - support ESMTP "AUTH LOGIN" authentication; - DNS lookup to send email without specified smtp server;...
 
sslmimesendmailsecuretcpemailtcpipdns lookuppopcomponentsmtp ocxadminsystememailarchitecttlsipv6activexesmtpoutlooklibraryimap4dll
NetSpeeder

Shareware by Superhunter
44 x 2574Kb downloads

...network, downloading speed will be several times faster. DNS Accelerator will automatically update hostname and IP Address...
 
wirelessdnscablespeed-upweb acceleratorimmunize activexmodemsimplytweakinternetnetworkadsl
Advanced Maillist Verify

Shareware by EMMA Labs
19 x 3538Kb downloads

...Advanced Maillist Verify (AMV) is a program that verifies the validity of e-mail addresses in databases, address books and mailing lists. Now that`s not just a standalone program -...
 
vrfyaddress verificationverifyingverifingdeadeverifymailaddress correctioncheckingvalidatorcomponentdelivery erroremail verifierwabvalidationmailing list managercheckermailverifyamve-verify
N-Manager

Shareware by Nicomsoft Ltd.
5 x 776Kb downloads

...set of functions. Also N-Manager provides a COM ActiveX interface for all API functions so you can...
 
connectionnetworklibrarypingmacvistamanagetoolwindowstcpdevelopersharewarecomponentdns
Free Vista Files award
...MailBee SMTP ActiveX component enables Windows and ASP applications to compose,...
 
attachmentdirect sende-mailgmailvisual basicheaderqueuemimeesmtpdlldelphirelaycoldfusionobjectemailvbaaspocxntlmiissslcomponenthtmlgssapimessagecomposeactivexvb6mail merge
...The conaito WhoIs.dll is a powerful .NET component for whois searches. You can easily integrate Whois searches with your application using any .NET language. The conaito WhoIs.dll was...
 
dllaspnetlookupcomponentfreedomainactivexdnswhois
Free Vista Files award
...SIP SDK for .NET and ActiveX - A powerful and highly versatile VoIP SDK...indication * Mute microphone/speaker for each line * DNS SRV resolution for SIP servers (RFC 3263) *...
 
voice conferencevoice conversationtext conferencesip dllsip activexrtpvoip libsip softphonevoip componentsip libvoip chatvoip sdkvoip activexsip rtpvoip conference softwaresip sdk
...VoIP SIP SDK for .NET and ActiveX - A powerful and highly versatile VoIP SDK...indication * Mute microphone/speaker for each line * DNS SRV resolution for SIP servers (RFC 3263) *...
 
voip chatvoip conference softwaresip sdksip activexsip dllvoip componentvoip activexsip libvoice conversationsip rtpvoip sdkvoice conferencesip softphonetext conferencevoip lib
...indication * Mute microphone/speaker for each line * DNS SRV resolution for SIP servers (RFC 3263) *...
 
sip libsip dllsip softphonesip activexvoice conversationvoip conference softwarevoip libsip rtpvoip componentvoip chatvoice conferencevoip sdksip sdkvoip activextext conference
...SIP Phone DLL for .NET and ActiveX - A powerful and highly versatile VoIP SDK...indication * Mute microphone/speaker for each line * DNS SRV resolution for SIP servers (RFC 3263) *...
 
sip activexvoip componenttext conferencevoip libsip dllvoice conferencesip rtpsip libvoip activexvoip conferencesip softphonesip sdkvoip sdkvoip conference softwarevoice conversationvoip chat
...Content Filter Web Proxy Server has an intelligent DNS cache, an extremely manageable content cache system, and...
 
network securityproxy serverinternetcontent filtercacheaccess controlinternet securityantivirusblock accessfreesoftwareauthenticationblacklistfirewallweb filterinternet gatewayinternet filterparental control
...Content Filter Web Proxy Server has an intelligent DNS cache, an extremely manageable content cache system, and...
 
access controlfirewallsoftwarenetwork securityparental controlinternet filterblock accessauthenticationcontent filterweb filterinternet securitycacheproxy serverantivirusinternet gatewayblacklist
wodSmtp

Shareware by WeOnlyDo Software
3 x 3928Kb downloads

...message directly to users SMTP server *Has included DNS client to resolve addresses and domain names *Supports...
 
e-mailsmtpsmarthostcomponentweonlydoreliable delivery protocolactivex client
BrowserObject .NET Control Gold Edition

Commercial by BrowserObject.com
4 x 2001Kb downloads

...Installed, Connection Wizard Version, Internal IP Address, Reverse DNS Lookup, Proxy Used, Proxy String, OS Name, OS...Version, OS Architecture, NetMeeting Build, ActiveX Enabled, JavaScript Build, VBScript Enabled, VBScript Build, Java...
 
browser detectionbrowscapiniuser agentflash detectionbrowser capabilitiesbrowser identificationjavascript detectionbrowser sniffingbrowsepcap