1 2 3 4 5 6 7 8 9 ... 71 72 73 74 75 76 77 78 79 80

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...your CD and DVD autorun your documents or display an autorun menu in a few simple steps,...corresponding programs to open your documents. If some software is missing then the user can be directed...
 
menuautorun downloadautorun htmlcdstartdummyautostartautoplaycreate autorunautorun filemmbauto playautoruninfautoplay menuautorun creatorautoplay mediaautorun software
Network Protocols Map Screensaver

Freeware by Javvin Company
208 x 2000Kb downloads

...wall-papers for IT/Networking professionals and students, who will display our art on their computer screens for months...or years. Screensavers are widely displayed on people`s PCs for months, even years. Marketing...may also bundle a small demo of your software or other products with the screensaver and distribute...
 
networkingserverrouterwlancommunication protocolswitchpacket analyzerprotocolsciscoprotocol postertroubleshootingtcpipethernetprotocol analyzer
OSI Model Screensaver

Freeware by Javvin Company
112 x 2441Kb downloads

...wall-papers for IT/Networking professionals and students, who will display our art on their computer screens for months...or years. Screensavers are widely displayed on people`s PCs for months, even years. Marketing...may also bundle a small demo of your software or other products with the screensaver and distribute...
 
wlanprotocolsosi modelcommunication protocolciscopacket analyzertcpipprotocol analyzertroubleshootingserverprotocol posterrouternetworkingswitchethernet
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...shabby, eh? With valid website code, your pages display consistently in different browsers, work better with CSS,...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
...Vevo! eSales is comprehensive emarketing software to facilitate both digital catalog and digital marketing....successful catalog driven business. Unlike most Digital cataloging software or Digital Marketing Solutions, it focuses on critical...
 
digital marketingdigital catalogemail campaignssales presentationscatalog presentationsemarketing
Alien IP

Shareware by ArmCode
89 x 16931Kb downloads

...Alien IP is trace routing software that resolves domain names, pings IP addresses, and...notations; - Calculate IP ranges and subnets; - Display domain location and coordinates....
 
searchwebgeolookuphostpositionaddressresolve
iNetFormFiller Free

Freeware by iNetFormFiller
56 x 3487Kb downloads

...it to you the same way it was display on the corresponding web site. The process of...
 
online form toolsweb form fillerpassword keeperpassword manager
LingvoSoft Free Talking Dictionary English <-> Portuguese for Pocket PC

Freeware by ECTACO, Inc.
95 x 2102Kb downloads

...the most recent Pocket PC platforms. While the software now supports screen rotation in Windows Mobile 2003...SE, virtual keyboards allow the display of European diacritics on devices with a non-European...mode
* Virtual keyboards support VGA and can display European diacritics on devices with a non-European ROM
...
 
pronouncetranslateectacolingvosoftdictionaryspeak
...This software contains following functions: - Guards specified e-mail boxes...is announcing new icoming messages. - Loads and displays headers of e-mails (date, sender, subject and size)....- Can download complete selected message, but will display it without any formatting and will not lauch...to mark sender as spammer. - SSL supported. Software is very suitable even in the case, when...
 
spame-mailpop3spam filterantispam
NTP Time Server Monitor

Freeware by Meinberg Radio Clocks
104 x 1458Kb downloads

Free Vista Files award
...The NTP Time Server Monitor software allows the user to control and configure the...Extract the NTP related application log entries and display them separately in a table. The user can...filter the entries by categories. - Display the current status of the running NTP service....stratum value and the selected synchronization source is displayed in a status string. The status is automatically...
 
network time protocoltimeservermonitortime synchronizationntpntp time serverservicestratum
...can control the list of files to be displayed in the File Manager by using filters. Feature...
 
mergefilevisualexceldocumentmodulebasicsourcevbacompareutilitycodesoftwaredifferenceprojectsheetmacrosversionsynchronizetool
Salaat Time

Freeware by Salaat Time
141 x 14351Kb downloads

Free Vista Files award
...at the prescribed times the Athan sounds and/or displays visual alerts. In addition you have a perpetual...
 
prayer timesmuslimathanhijri calendarathansislamprayer softwareazansqiblah direction
Exsate DV Capture Live

Freeware by Exsate Software
143 x 1695Kb downloads

Free Vista Files award
...recompressing to other formats in realtime. Key features: Display DV date/time stamp - detects recorded DV date...more comfortable: - wizard like user interface; - display a capture progress; - automatically rewind a tape...
 
softwareminidvmoviewmvvideompgmpeg2daterecompressdivxmpeg4toolasfvcdcapturestampdvdsvcddvc
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...thumbnails window. You’ll find user friendly features to display your 3D and images files. 3DBrowser recognizes more...format: 3DS,LXO,DAE,LWO,SKP,MAX,XSI,OB J,STL,DXF,MA,JPEG, TIFF, PSD, BMP,GIF, AVI,SWF,MP3… >> Display your files the way you want: View your...thanks to the multi-folders browsing capabilities. A customizable display mode allows viewing the information you need such...3D files in the built-in OpenGL viewer.
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
...Tray Skins: http://drive-software.com/... "Several useful features." Adding seconds display to system tray clock > Is there any...way to have the seconds display > on the system tray clock? Clock Tray...do I make WinXP Pro`s System Tray Clock display > seconds in addition to hours and minutes...http://www.drive-software.com... Best systray clock I have ever found! Displaying seconds on tray > Hello, > > Is...
 
show date tray clockdesktop clockshow seconds tray clockwindows clock
yRead2

Freeware by Spacejock Software
55 x 11251Kb downloads

...a plain text (TXT) or HTML file and display it in a single-column, resizable window. Then it...you`ll havx to livx with the consxquxncxs. Free software from the author of the Hal Spacejock series....
 
speechtextreadervoices
FCharts

Freeware by Spacejock Software
80 x 3194Kb downloads

Free Vista Files award
...price data from a wide range of sources, displaying it as OHLC, Candlestick and Line charts. It...your own with the inbuilt formula language and display them as standalone charts or overlays. You can...in full colour or black and white. Free software from the author of the Hal Spacejock series....
 
chartingsoftwarefreestock
Express Talk VoIP Softphone

Shareware by NCH Software
199 x 684Kb downloads

Free Vista Files award
...to put calls on hold. ~Supports caller ID display and logging. ~Includes a phone book with quick...Player, VRS Recording System and more. About NCH Software NCH Software is a leader in audio, video,...dvd, telephony, dictation, transcription, business, and computer utility software for Windows, Palm, Pocket PC and Mac OS...
 
sip softphonevoip phonetelephonysoftphone softwaresip phonepbxexpress talkvirtual pbxsoftphone sipcomputer phonecomputer softphoneinternet phone
SSE Setup

Freeware by Chris Long
70 x 5795Kb downloads

Free Vista Files award
...hardware / OS`s / software; can download needed software (runtimes) * For .NET installs, easy framework download...Ability to digitally sign installer/uninstaller/your program`s files * Display license agreement user must agree to * Install...Play audio files * Associate filetypes with your software * Create/Run/Delete Task Scheduler Tasks * Modify security...
 
setupuninstalleruninstallationmsiinstall creatorprogram installer
FtpRight

Freeware by FtpRight.net
51 x 5475Kb downloads

...your own FTP sites is easy. Note: This software works similar to CuteFtp, WSFTP Pro and FTP...
 
freeftpsoftwarereceivefreewareftprightfreeftpprogramcommandexplorerbulletproofvoyagerftpclientfilesecureanonymousbrowsersmartsendprotocoldreamcastpublictransferexpertsharewareleechresumeleapsearch