1 2 3 4 5 6 7

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Video Download Studio

Shareware by aHisoft
31 x 27566Kb downloads

...Online Video Downloader / Total Video Converter / Powerful Media Player [Video Download Studio] is a powerful video downloader and converter tool which can help you download videos and free music from...
 
download videosdownload veohdownload imeemdownload revverdownload breakcomdownload dailymotiondownload vreeldownload bliptvdownload youtube videosvideo downloadsvideo downloaderdownload free music
Video Download Capture

Shareware by Apowersoft
38 x 27913Kb downloads

...With Video Download Capture, anyone can free online video download and conversion. Users can efficiently download online videos from YouTube, Dailymotion, Megavideo etc, then crop, trim or convert videos as...
 
download googledownload online videodownload megavideoconvert online videodownload free videodownload youtubedownload music videodownload dailymotiondownload metacafevideo download
AHD Video Downloader

Shareware by AHDSoft
7 x 14458Kb downloads

...Users can efficiently download online videos from YouTube, Dailymotion etc, then crop, trim or convert videos for...
 
online video downloadervideo localvideo converter
video4pc Downloader

Freeware by video4pc.com
13 x 3747Kb downloads

...video4pc Downloader is a free tool for downloading the streaming video files from the most famouse video sites (...
 
youtubevideo4pc
Bywifi Video Downloader

Freeware by Bywifi
188 x 8589Kb downloads

Free Vista Files award
...Bywifi Video Downloader is a free program for downloading, transcoding and P2P accelerating video streaming. It supports downloading, transcoding and P2P accelerating videos from all video websites, such as Youtube,...
 
video transcodeyahoovideo downloadyoutubemyspacedailymotionmetacafe
GetGo Download Manager

Freeware by GetGo Software Ltd.
670 x 5829Kb downloads

...Free Complete Online Video, Music and File Download Manager with YouTube Download Support. This Free Downloader is an Essential Internet Tool for Increasing Download Speed, Resuming, Scheduling, and Organizing Downloads....
 
video downloaderfree download manageryoutubeyoutube downloaderfacebookvimeodailymotiongetgointernet download managerbreakflvmegavideovideo download manageryoutube download managerdownload acceleratorspikemetacafe
Leawo Free YouTube Downloader

Freeware by Leawo Software
16 x 13012Kb downloads

...Leawo Free YouTube Downloader is one of the best tools that can download FLV files from YouTUbe, Yahoo, Google, MySpace, iFilm, Dailymotion, Metacafe, etc. with convenient download methods, such as...
 
download flvconvert flv videoconvert youtube videoflv video converteryoutube converteryoutube video converterflv downloadyoutube flv downloaderyoutube downloadyoutube downloaderdownload youtube flvflv converter
GetGo Download Manager Program

Freeware by Adnuker.com
2 x 4578Kb downloads

...Free Complete Online Video, Music and File Download Manager with YouTube Download Support. This Free Downloader is an Essential Internet Tool for Increasing Download Speed, Resuming, Scheduling, and Organizing Downloads....
 
toolmegavideovideo downloaderflvdownload acceleratorfacebookbreakdailymotionyoutubeinternet download managerspikevideo download managerfree download manageryoutube downloadervimeogetgoyoutube download managermetacafe
Speedbit Video Accelerator

Freeware by Speedbit LTD.
333 x 2105Kb downloads

Free Vista Files award
...Speedbit Video Accelerator 3.3 is a ground breaking application that lets you enjoy the world of internet video without long frustrating waits. Video Accelerator provides fast streaming of web...
 
bufferingstreamingvideoaccelerationespnhigh definitiondownloaderbreakyahoohigh qualityitunesflashaoldailymotionflvveohacceleratorgrabbercnnmyspacevideo acceleratormetacafeheavyfacebook
...The brand-new Ashampoo ClipFinder HD gives you web video the way it should be. Search in up to fifteen video portals at once or in selected portals, view videos...
 
youtubeveohvideo playermyspacecomyahoo videogoogle videovideuvimeovideo sevenloadvideo viewerdailymotionmp3 downloadspikemetacafeclipfishlivevideoashampoo clipfindervideo search
Easy FLV Player

Freeware by YoutubeGet
3 x 394Kb downloads

...Easy FLV Player is an easy-to-use and completely free flv player to play flv videos on your local PC standalone. You can...
 
freewareflv playerplay flvyoutube playerfree flv player
TubeBox

Freeware by TubeBox
1 x 1063Kb downloads

...TubeBox is a free multimedia downloader and converter and brings a lot of new features with it. The tool supports numerous video and music portals such as YouTube, Vimeo, DailyMotion,...
 
youtubeconvertervideovideo portalsoundclouddailymotionvimeoipodipadyoutube downloadervideo clipmp3funny dietubeboxmusicdownload managermobilempegvideo downloaderfree youtube mp3audio
4K Video Downloader

Freeware by Open Media LLC
1 x 6367Kb downloads

...4K Video Downloader allows to download and save video, audio and subtitiles from YouTube in the high quality on your computer. Facebook, Vimeo, Dailymotion, Redtube and RaiTv are also supported....
 
youtubeyoutube downloadyoutube mp3youtube downloaderyoutube videofree
...YouTube Downloader org 4.0. - is a program that can save video from Youtube.com, as well as any other tube sites such as: dailymotion.com, metacafe.com, break.com,...
 
youtubecomfree download youtubesave youtubesave videoyoutube downloader
4Media Online Video Downloader

Shareware by mp4converter.net
2 x 19704Kb downloads

...4Media Online Video Downloader is a fantastic online video downloader which enables you to logon online video websites with large popularity directly, watch interesting online videos and download them instantly...
 
online video downloaddownload online videosdownload flv videosonline video downloader
Bulk Image Downloader

Shareware by Antibody Software
46 x 5726Kb downloads

...(with HD download support) * Google Video * DailyMotion (with HD download support) * MetaCafe * Youp**n...
 
thumbnaildownloaderpicturemetacafeflickr downloaderpornhubgalleryimagevenuefuskeryoupornyoutubemegapornimagefapmegavideodeviantarttube8dailymotionredtube
Free Online Video Downloader

Freeware by 77Freeware
16 x 1181Kb downloads

...Free Online Video Downloader enables you to view online videos from most popular online video websites and download your interested ones instantly and rapidly.It allows you to logon the...
 
freewaredownload online videosfree online videos downloader
Online Video Hunter

Shareware by Gskstudio
14 x 3807Kb downloads

...Online Video Hunter - Professional FLV Downloader, 1000+ websites supported. Online Video Hunter allows you to easily download flv videos from Youtube, Dailymotion, Myspace, Vimeo, Google, Heavy.com, Youp**n, Youjizz,...
 
download flv moviesflv downloaderdownload flv videosdownload flv music
KeepVideo

Shareware by KeepVideo.info
3 x 506Kb downloads

...KeepVideo is an excellent software to download and play videos from YouTube , Facebook, Dailymotion, and many other video sites. Features: 1.Multiple video websites KeepVideo allows you to easily download...
 
download youtube videobuilt-in player
AN YouTube Downloader

Freeware by SaveTubeVideo
5 x 12289Kb downloads

...AN YouTube Downloader 3.9. - is a program that can save video from Youtube.com, as well as any other tube sites such as: dailymotion.com, metacafe.com, break.com,...
 
save videodownload youtubefree download youtubeyoutubecomsave youtubeyoutube downloader