1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SQLWriter

Shareware by ljcsoftdev
84 x 2012Kb downloads

Free Vista Files award
...edits or runs SQL queries and scripts with code completion. You can browse the SQL result data...can create or modify the database template to customize everything! So this SQL tool can help you...object which showed in database schema tree or code completion list.Customize database object pop menu. Change the...the keywords of SQL script and you can custom the keywords by yourself. Show the objects of...it). Export and import database table’s data.
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
EControl Syntax Editor

Freeware by EControl Ltd.
77 x 952Kb downloads

...The unique and more important feature is 100% customizable lexer, so you can adjust it for any...Localized: English, Russian, German; - Split screen; - Customizable text folding; - Customizable text structure tree view;...- Customizable keymapping; - 100% customizable lexer (syntactical analyzer). Comfortable visual lexer editor; -...lexers in one using "Sub Lexer" rules; - Code templates; - Auto-correction; - Spell checking; - Print/...
 
aspspell checkingeditfoldinganalysishighlightingsyntaxhtmlxmlformateditorcontrolplain textkeymappingcode editorphplexer
Developer Tool Marketplace News Screensaver

Freeware by DevDirect
47 x 674Kb downloads

Free Vista Files award
...Find out about the latest software components and custom controls as they become available using Dev Direct`s...an essential tool for software developers that use custom controls, software components, code generators and other productivity...market for developer products to ensure that our customers get the best tools for the job, every...
 
cbdclassutilitycbuilderdotnetvbnetbeansaddinaspnetreusecnetdevelopmentclxvisual basicaddonactivexcodecomponentcomponettoolvisual studiodeveloperobject
Fingerprint SDK

Trial by Griaule Technology
227 x 16598Kb downloads

Free Vista Files award
...support for dozens of programming languages, richness of code samples, and its thorough documentation, you`ll start developing...seamlessly add fingerprint recognition to their programs, creating custom one-to-one verification and one-to-many identification applications, such as...and DLL components are available to use. Sample codes provided; * Support for internet Java applets; *...
 
software componentbiometricsmicrosoft fingerprint readerjavadelphicrossmatchfingerprint recognitionlibrarysdkuareusoftware development kittesctech bio-isecugen hamsterappletdigital persona
mosascii m2

Freeware by Robert DeFusco
57 x 5257Kb downloads

Free Vista Files award
...mosascii m2 is an application that converts an image into an HTML mosaic made out of ASCII characters. mosascii m2 can also create animated HTML mosaics. The HTML mosaics and...
 
convertrandom lettersmachine codesmart textsoftwaredefuscofastfontansifreewarefunproductivitycustom textroberteducationalhexdesktop publishinganimatedeasymosaicmosasciianimationrandom numbersbinaryhtmlgraphics

Freeware by Altova, Inc.
64 x 9987Kb downloads

Free Vista Files award
...transforming XBRL documents. There is no license key code required to activate AltovaXML, and developers may use...
 
xslt enginexml validating parseropen xml parserxqueryxbrl dimensionsxbrl validatorxml validation
...password, etc), drop-down menus and other toolbar elements. Custom images and elements can be inserted, too. Average...can add a number of features into a custom toolbar: • Visual Basic and JScript scripting support...several times a year • IE skins and custom background color • Custom toolbar objects, such as...search on different search engines • Signing toolbar code with a Digital Certificate • Toolbar configuration menu...
 
softwarebuildgoogleietoolbarsharewarealexadeskbargeneratedesignerdynamicexploreriebarfreewareconstructorconfigurecreateautoadwarewizardcompile
Macros Runtime

Freeware by S&G Team
19 x 4295Kb downloads

...expand your applications with scripting, user forms and custom properties. Customers can customize their software and meet...processes; - Create and manipulate objects; - Reuse code and speed up development cycle; - Reduce costs...
 
debugvbscriptperldevelopmentpythonapplicationactivexembeddedintegratescriptingtoolscontroljscriptmacros
...own matrix! This screensaver emulates the falling green code as seen in the hit movies "The Matrix",...screensaver features to tweak, including setting your own custom music to play along with the screensaver, and...
 
landscapecustomgreenglyphrevolutionsenterbackgroundscreensaverreloadedthe matrixrelax

Freeware by Eden Systems LLC
12 x 420Kb downloads

...various edit widgets, search level, and hooks for custom code. zCFac uses a common description to automatically...
 
web development toolprogramming tooldynamic web applicationmacdynamic querydata access objectsjava code generator
FreeWire

Freeware by FreeWire P2P
121 x 245Kb downloads

...and much more. You can organize and play custom MP3 playlists with FreeWire`s built-in MP3 player, and...is free, open source software based on LimeWire`s code base. It features no banner advertisements in the...
 
mpegpicturessoftwaresharefasttrackfreenetgnutellaaudioimageskazaaimeshfreewiregamesbearsharemusicmorpheusinternetmpgmp3searchingvideolimewirechatmoviesopennapnapster
KATE

Freeware by Haptek Inc.
27 x 2870Kb downloads

...the Sonork client to enable living, winking, breathing custom avatars that speak the messages coming and going...incoming messages spoken by the sender`s character Supports customizing the Avatar’s appearance, shape, size, voice and background...such as :) , ;), :-O, J, etc. Custom 3D avatars can be created choosing from several...
 
peoplecommunicatemorphputtychatavatarmessagesystemhapteksonorkcharactertextinstantspeechvirtualfriendsapi
netChimes

Freeware by Birnam Labs
18 x 1857Kb downloads

...that will trigger an alert. Webmasters can create custom error pages to send alerts. The possibilities are...
 
statisticsnetchimescountmessengeralertvisitorwebmasterweblog

Freeware by newObjects
26 x 3100Kb downloads

...based on the popular SQLite public domain source code it adds some features useful for Windows programming...recordsets in a fashion that needs times less code than the traditional recordset based DB interfacces. Combined...
 
interfaceembeddedtriggerdatabasesqlzero configurationengine
PSPad editor

Freeware by Jan Fiala
2 x 3525Kb downloads

...conversion, text differences, templates, macros, spellcheck option, auto-completion, Code Explorer and much more. The program is pre-configured...PHP, ASP, Python etc.) and you can further customize the syntax settings. PSPad includes several additional tools...Additional features include support for project, file browsing, custom shortcuts, built-in FTP client to edit files on...
 
zadarmozdarmapspadphp editorxhtmlhex editorfreewareaspeditorsjavascriptperl
PE Explorer

Shareware by Heaventools Software
28 x 3724Kb downloads

Free Vista Files award
...OCX, SCR and other win32 executables. Support for custom plug-ins. Use it for serious development projects, for...determination of the existence of viruses or malicious code in the programs, to reverse engineer projects with...
 
syntaxexeiconresourcedecompilerdelphiviewerdisassemblerimportbitmapextractdllpngeditor
Free Vista Files award
...with functions pre-wired to handle tasks you must code in other tools. The second is rapid deployment....executables that can be run from within any custom app or database....
 
functionscommandnetworkautomatetasksystem integrationcompilerkeystroke recordersoftware integrationprograminterface controldemoscriptinstallsharewarebatchmacrowinbatchsmswebbatchrolloutcnemcse
DisCat

Shareware by Genutronics Ltd
14 x 4268Kb downloads

...with DisCat, then put a number or letter code on the CD for filing purposes. Once you...DisCat directory on your hard drive. You can custom configure the DisCat scan settings to archive only...
 
organizedata
LinkAlertPC

Shareware by InBloom Products
8 x 4470Kb downloads

...forms of alert notification - Dialogs, Sound, Email, Custom Logging, Phone and Application execution. Features: Link types...
 
networkhttpsserviceftpfileemailmonitorlanibpfolderdiskinbloomtcplinkalertpcnotificationprinter

Commercial by WebAsyst LLC
22 x 3079Kb downloads

...tool - Advanced product search tools (search by custom parameters) - Order SMS-notifications - Integrated with Google...PREMIUM is extremely flexible - you can freely customize it to meet your demands. However, if you...an advanced user and do not wish to customize the software, you do not have to -...
 
ecommerce shopping cartshop scriptturnkey ecommercephp shopping cart