1 2 3 4 5 6 7 8 9 ... 47 48 49 50 51 52 53 54 55 56

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...performance can be monitored by the SAP Module. Website monitoring involves URL Monitoring , URL Sequence Monitoring,...Server (Apache & IIS).Custom Monitors enables you to create JMX consoles and SNMP Consoles and to monitor...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
ThunderSite Free Web Editor

Freeware by Generalia Software
352 x 12164Kb downloads

...belongs to a new generation of high quality website editors that allow you to create professional-looking websites...in record time and with maximum ease. To create a website with ThunderSite, you do not need...have to bother with the technical part of website creation; instead, you can focus all your efforts...on the site content! Features: - Professional-looking Website Graphic Templates - WYSIWYG editing (like any Word...
 
htmleditoreasilycreationinternettemplatebeginnerdesigncreateeasywebsitepagescreatorbuild
RapidSMTP Free Edition

Freeware by RapidSMTP.com
72 x 10904Kb downloads

Free Vista Files award
...an award winning high-performance e-mail marketing software to create and send personalized marketing e-mails. Send e-mails at...Use DynamicText to merge database fields and to create messages with individual content and appearance. Send geotargeted...Android..) or users, who have not visited your website for a defined time span. You can use...
 
mailingnewslettersgeolocationmailinglistemailmysqlmarketingsendbulkemails
Idaho-Web-Counter

Freeware by Implied By Design
99 x 248Kb downloads

...information from you, and doesn`t require you to create an account to use. Use as many counters...
 
web page designweb design freewarewebsite designhtml designhtml toolsweb toolsfree web softwareidaho web counter
Advanced Diary

Shareware by CSoftLab
155 x 21023Kb downloads

...is fully supported. Using this program you can create not only text diaries: audio and video recording...
 
diary softwarecalendarjournalelectronic journalelectronic diarydigital diarydiary programjournal software
Cayman Browser

Freeware by caymanbrowser.com
77 x 1677Kb downloads

...in a web page and show each url`s create date, file size, link state *Links filter: Select...
 
webbrowser
NeoPhoto

Freeware by DTLink Software
108 x 3973Kb downloads

Free Vista Files award
...captions included. Turning your photos into an attractive website is as easy as pushing a button. Capture...
 
publishredeye reductionphotoalbumcameradigitalweb pageorganizeresizepostthumbnailrotatescreen shotgalleryemailimage
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...Advanced web design for everyone. You want to create great websites, totally stellar, kick-butt websites that leave...Editor your new best friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...everyone - not too shabby, eh? With valid website code, your pages display consistently in different...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
smc WebStore Free

Freeware by smc technologies, Inc
94 x 4146Kb downloads

...Create an online catalog and sell your products online with a FREE ecommerce solution. Designed to be easy to use for the small business owner with little or no HTML...
 
e-commerceecommercestorefrontshopping cartsshopping cart programsebusiness softwareshopping cart softwareeasy shopping carte-business softwareshopping cart systems
rss2html

Freeware by NotePage, Inc.
83 x 28Kb downloads

...browser. FeedForAll`s new rss2html.php script allows users to create webpages that will always display the most current...the format and look of the web page created from the feed. The RSS feed`s contents can...
 
rss2htmlfreenews feedrdfphp scriptxml feedtoolconvert rss htmlconversionintegratecomponentconvert xml
Adsen FavIcon

Freeware by Adsen Software
114 x 613Kb downloads

...color quality you choose. Not only can you create fav icons, but it can also be used...
 
fav iconfavicoicomake favicon filefavicon freewarefree favicon downloadcreate favioconhow make faviconfavicon maker

Shareware by Altstone Software
53 x 12473Kb downloads

...analyzer capable of representing geographical stats on your website visitors in a self-explanatory visual representation on the...even towns within a country for a particular website in order to optimize bandwidth and content language;...on a particular national market). In this case, website owners have to invest more in hosting solutions...for everyday use by a web marketer. Simply create a project, specify which log files to analyze...
 
server logslog analyzerlog analysisweb site statsweb statisticsactivityapachevisitorsweb site analyticstracking
Free Exam

Freeware by Free Exam Project
84 x 4973Kb downloads

...The Free Exam Project is a website for students and instructors looking for and to...By downloading the Free Exam application, users can create and run their own practice exams. By submitting...the exam they created to the website, others can download that exam...
 
ccnanovellccdacnecollegefree exam projectmicrosoftcertificationmcsepractice examciscoinformation technologysecuritycomptiauniversitytestlinuxhigh school
...HTML frames is a must for all good websites today. But when doing menues in pure CSS...
 
utilitywebdesignwebmasterhtmlcss
Baseball Browser

Freeware by 4ComTech
23 x 1318Kb downloads

...delivers easy access to the best baseball news websites (ESPN, Fox Sports, The Sporting News, Sportsline, Yahoo...team websites, and topics associated to the current website you`re viewing. It features a configurable integrated search...
 
baseball browserbaseball software programscreate web browsermake your own browserhow create web browserbaseball web browserbaseball sports newsbaseball appshow build web browserfree baseball software
DVD-Cover Printmaster

Freeware by biu software
433 x 560Kb downloads

...the images for you. Makes it easy to create great looking covers for any cases. This software...a build-in browser. Import covers direct from a website by simply dragging the images from the website...
 
svcdfilmprintmusicvhscoversaudiodvdlabelbookletmovie
...sound (.wav), Adobe *.pdf files, Power Point *.ppt, website *.htm , *.doc, *.xls or stand alone *.exe...be edited in any word processor or automatically created using the content management software. Simple multiple choice...content management software will also allow you to create a website as well as all of the...
 
cmspowerpointmedia libraryvideocontent managementbrochuresmultimediaminicatcatalogue
ReplaClude

Freeware by Locazing Inc.
32 x 49Kb downloads

...files as a source file. Instead, it will create result file (Target file). Replace and Include rule...Since ReplaClude is Excel VBA application, you can create more complicated configuration useing Excel functions. It is...
 
replaceincludeinsertconfigurable
Aspose.WebEffects

Freeware by Aspose Pty Ltd
27 x 1191Kb downloads

...Aspose.WebEffects is a totally FREE ASP.Net component that enables developers to Add flare to you ASP.Net website;add spice to any bland web page. WebEffects allows developers...
 
generationexcelvbachartpictureprintworksheetrangetablecreatorfreecellcreationformattingadd-inspreadsheetreportingchartingfilecreatecommentspivotauto-filterfunctionsasposewebeffectsgenerateformulas
Namu6 Website Editor

Freeware by Namu6 Ltd.
29 x 4015Kb downloads

...way to create, maintain, and publish a website. Create a small business, photo journal, student or personal...best suited for people who want hassle free website maintenance and don`t want to spend time editing...
 
webdesignvisual editorwebsite designhtml editorweb designe-commerceecommercevisual website editorcreate websitefreewarewebsite builder