1 2 3 4 5 6 7 8 9 ... 39 40 41 42 43 44 45 46 47 48

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Free-Web-Buttons.com

Freeware by Free-Web-Buttons.com
17 x 10784Kb downloads

...Free Web Buttons helps you create cool web buttons and menus based on pure css with...ease. Free! It`s very easy to create professional high-quality Win7, iPhone, Vista, XP, Glossy web...buttons with the help of Free Web Buttons. Once installed you`ll be making buttons for...your web site with no programming or drawing required. Each parameter...change can be undone by pressing "Undo" button.
 
free web buttonsiphonecss rollover buttonswin7menus
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...completely new and unique way of updating your web site. Portello is a plug-in to Internet Explorer...to 65 mph! Press the button and your web page as you see it becomes editable, exactly...your changes will be saved instantly to the web server. You can cut, paste, create links and...in other ways edit your web page. You can add, rescale and compress new...
 
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing
ThunderSite Free Web Editor

Freeware by Generalia Software
352 x 12164Kb downloads

...belongs to a new generation of high quality website editors that allow you to create professional-looking websites...in record time and with maximum ease. To create a website with ThunderSite, you do not need...any prior knowledge of programming (HTML, JavaScript) or web design. Since most of the complex programming steps...have to bother with the technical part of website creation; instead, you can focus all your efforts...
 
htmleditoreasilycreationinternettemplatebeginnerdesigncreateeasywebsitepagescreatorbuild
Idaho-Web-Counter

Freeware by Implied By Design
99 x 248Kb downloads

...simple way to add cool counters to your web site. Just click on the counter style you...to your clipboard. Paste the code into your web page and you`re done! Idaho-Web-Counter allows you to...information from you, and doesn`t require you to create an account to use. Use as many counters...want, there`s no limit! It`s called the "Idaho" web counter because there are number of Idaho-inspired counter...
 
web page designweb design freewarewebsite designhtml designhtml toolsweb toolsfree web softwareidaho web counter
Tetris Planet

Freeware by MyPlayCity.com
612 x 1702Kb downloads

...and Creator does the opposite, enabling you to create a block anywhere you wish, again by pressing...Top 10, you can upload it to our Web site and thousands of other players all over...
 
linesplay tetristetris downloadfree tetris
FineBrowser Free

Freeware by SoftInform
71 x 3958Kb downloads

...FineBrowser allows you to view multiple web pages in a single browser window. It includes...annoying popup blocking and clearing any trace of web surfing. The Quick Groups Manager allows you to...you to open multiple links from the selected web page area, or all links within the current...visit. And you can gather images from the visited pages both in manual and in auto-mode. Also...
 
pop-up killerinternet explorermultibrowserinternet surfingalternative browserbookmark managerblock pop-up
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great...websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...Editor your new best friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
smc WebStore Free

Freeware by smc technologies, Inc
94 x 4146Kb downloads

...in checkout area and administration screens for our web based edition. Capability to link to products and...
 
e-commerceecommercestorefrontshopping cartsshopping cart programsebusiness softwareshopping cart softwareeasy shopping carte-business softwareshopping cart systems
Blog Navigator

Freeware by Stardock Systems
99 x 1093Kb downloads

...includes a host of different news and blog sites for users to read through. Blog Navigator is...pre-load all the articles on a given blog site to speed up reading. It also has a...of off-line reading features in which a blog site can be exported into a magazine-like format. Notable...no nonsense) - Can pre-load an entire blog site to make reading much faster - Included Tabbed...
 
stardockbloggingcommunicationbrowsingrss feedsinternet

Freeware by TM Services
67 x 8Kb downloads

...Google Sitemap generation by installing perl script at your web...download and install this perl script at your web server and you are able to create your...
 
submitperlsitemapgoogleonlinefreeware

Shareware by Altstone Software
53 x 12473Kb downloads

...Today, businesses are going online. Effective web marketing starts with the thorough analysis of your...potential customers` browsing habits, web site effectiveness monitoring and geo-targeting. Raw web server logs...lines of alphanumeric characters, which is what actually web server logs are. The right tool makes the...Geo Log Analyzer by Altstone Software, a unique web server log analyzer capable of representing geographical stats...
 
server logslog analyzerlog analysisweb site statsweb statisticsactivityapachevisitorsweb site analyticstracking
Free Exam

Freeware by Free Exam Project
83 x 4973Kb downloads

...The Free Exam Project is a website for students and instructors looking for and to...make practice exams on any subject. The site focuses on IT Certications, but is open to...By downloading the Free Exam application, users can create and run their own practice exams. By submitting...the exam they created to the website, others can download that exam...
 
ccnanovellccdacnecollegefree exam projectmicrosoftcertificationmcsepractice examciscoinformation technologysecuritycomptiauniversitytestlinuxhigh school
Advanced Tetric

Freeware by MyPlayCity.com
170 x 1927Kb downloads

...and Creator does the opposite, enabling you to create a block anywhere you wish, again by pressing...Top 10, you can upload it to our Web site and thousands of other players all over...
 
familysharewarecomputer gamearcadelogic gamefree tetrisplay tetrisfreewaretetris downloadpuzzleeducation
DevMansion JavaScript Menu Builder

Freeware by DevMansion
108 x 644Kb downloads

...Inside, you will find everything you need to create menus for Your site in minutes....
 
buildermenuwizardpopupjavascript
InfoGoGetter

Freeware by Pairowoodies
49 x 397Kb downloads

...to build up the content of a new site quickly. Just enter your new site`s primary keyword,...template before you click the `Generate` button and create a web page out of the result....
 
articleshtmlinfogoroundextractionconversion
Site Map Builder .NET

Freeware by SiteMapBuilder.NET
55 x 1362Kb downloads

...Site Map Builder allows you to create the Google SiteMaps XML needed within your root...directory in order to provide information about your site to Google. This XML must have some syntax...will generate for you Extract links from a site recursively Extract links from a single page Edit...and delete link properties Generate Google Site Map XML or TXT Save map as Google...
 
sitemaps buiildersitemaps validatorxmlsitemaps generatorsite mapsgoogle sitemaps
dbQwikSite

Shareware by TheDevShop Ltd.
38 x 20062Kb downloads

Free Vista Files award
...amazing, powerful, innovative way to build data driven web sites. Create database web sites and never write...a line of code. dbQwikSite is a web application development tool with powerful features to: connect...to and/or create databases, generate interactive web pages, control page appearance, create site navigation, design...your site, and test right on your PC.
 
web designecommercephpweb builderweb developmentcode generatorweb authoringsite builderweb storeweb databaseaspnetonline databaseqwiksite
PictureNook

Shareware by Asygo
36 x 1581Kb downloads

...PictureNook - powerful web photo gallery generator. Features: 14 preinstalled gallery layouts...5 preinstalled gallery styles Ability to create your own gallery layouts and styles What you...see is what you get interface Ability to create multi-level galleries Multi-level gallery hierarhy starts with collage...to smoothly deploy your gallery on your Internet site Professional version allows to embed your own image...
 
digital photopictures albumphoto albumpublish imagesweb photo albumweb gallerypicture galleryweb photo galleryslideshowcreate web photo gallerywatermark
Baby Album - Basic Edition

Freeware by VIRTUALSOFT
60 x 7618Kb downloads

...This software lets you create a complete multimedia baby album for your child...a few clicks of your mouse, you can create your child`s web site and publish it to...pregnancy calendar, family tree, first Christmas, etc. - Create an album for each of your children, even...
 
curvevaccinationmultimediacalendarbirthfamilygrowthphotoclipsvideoalbumdiariespregnancypicturematernitybabymemoriesaudiobabieschildrenhealthbookletdiaryrecordmemorydrawing
eePire - Expired Domain Finder

Freeware by nr4
35 x 7544Kb downloads

...find out more information about how popular the site it, inlcuing Alexa Information, and much more. The...
 
expireddomainfindereepire