Sort by : ReleasedNameDownloadsAddedRatingRelevance
MapMaker for PalmaryClock

Freeware by PalmarySoft. Ltd
138 x 669Kb downloads

...GIF desktop image format so you can easily create your own maps with the help of your...
 
jpgoriginalcreatetoolpowerfulgraphicpalmpalmaryclockeditnicemapgif
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...Data compression utility, which allows you to quickly open,...
 
protectingdocumentsprogramstoolschaossoftwarecompresssourcecodesafetysecurityfolderscryptographic algorithmsfiles
CHAOS Generator

Freeware by Safe Soft Corporation
101 x 116Kb downloads

...any length and character content. CHAOS Generator will create alphabetic, numeric, alphanumeric or all keyboard characters passwords...
 
securitynumberchaossoftwaredocumentsencryption systemprogramsgeneratorprotectingcryptographic algorithmssourcerandomfilespasswordtoolssafetyfolderscode
Vizup Desktop Professional Business

Demo by Vizup
85 x 3048Kb downloads

Free Vista Files award
...Models that you create with the help of 3D modeling tools, as...
 
toolreducerreal-timedesignvrmlarchitectmodelsoptimizervisualizationreductioncompressionanimationcad
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...data and objects of any database. You can create or modify the database template to customize everything´╝ü...
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
Matrix Reloaded Screensaver

Freeware by EasyScreensaver.com
256 x 4606Kb downloads

...flexible authoring tool that makes it possible to create many different types of screen savers. This tool...lets you create screen savers based on Shockwave Flash, Image Slide...Show, Animations (FLC), Webpage and Movie (Quick Time, Mpeg, AVI...). You can...by the process of "desktop-screen attribute-screen saver attribute-setup". Created with Professional Screensaver Maker and ensure all are...
 
make screensavermake screensaver softwarescreensaver builderscreensaver makercreate screensaver
...supported. Since this version, Software-Promoter has ability to create user-defined reports....
 
promotersubmittertrialwarepromotionsoftwaresharewarefreeware
XSite

Freeware by Veign
82 x 1705Kb downloads

...XSite will load and parse any webpage into a simple structured view for displaying images,...email addresses. Easily grab all images in a web page by downloading them to a local folder....Get all emails, links, and images from any web page - Download images to a local folder...- Generate results reports - Create CSV files of any results...
 
extractemail addressesinternetwebpageimages
Mimosa Scheduling Software Freeware

Freeware by Mimosa Software Ltd.
189 x 1360Kb downloads

Free Vista Files award
...and context-sensitive help. You can choose whether you create timetables automatically or interactively and you can create...This free version of Mimosa allows you to create up to 80 events and resources (courses and...
 
schedulesoftwareschooltimetableuniversity
YourDir

Freeware by Z5Com Pty Ltd
147 x 68Kb downloads

...print windows directories or folders. It can also create Jpeg file of a Windows directory. Its a...
 
print treeprint pathsprint foldersprint folder structureprint directory structure
ManageEngine Applications Manager

Freeware by ZOHO Corp.
106 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...Monitoring, Oracle Application Server, JBoss Monitoring, Tomcat Monitoring, WebLogic Monitoring, WebLogic Integration Monitoring, WebSphere Monitoring, J2EE Web...performance can be monitored by the SAP Module. Website monitoring involves URL Monitoring , URL Sequence Monitoring,...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
Free-Web-Buttons.com

Freeware by Free-Web-Buttons.com
17 x 10784Kb downloads

...Free Web Buttons helps you create cool web buttons and menus based on pure css with...ease. Free! It`s very easy to create professional high-quality Win7, iPhone, Vista, XP, Glossy web...buttons with the help of Free Web Buttons. Once installed you`ll be making buttons for...your web site with no programming or drawing required. Each...change can be undone by pressing "Undo" button.
 
free web buttonsiphonecss rollover buttonswin7menus
ID3 renamer

Freeware by x2develop.com
358 x 87Kb downloads

Free Vista Files award
...and it`s already done. ID3 renamer can also create a new tag if there is none in...
 
tagtaggerid3id3 taggeraudio toolfolderbitrateid3 renamertaggingfreedbedit id3 tagscddbid3v2mp3id3v1tag editorbatchfile renamerename mp3id3 tag editorfile renameralbummusic
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...completely new and unique way of updating your web site. Portello is a plug-in to Internet Explorer...to 65 mph! Press the button and your web page as you see it becomes editable, exactly...your changes will be saved instantly to the web server. You can cut, paste, create links and...in other ways edit your web page. You can add, rescale and compress new...and folders between your local drive and the web site like you would with any FTP client....
 
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing
...The CryptoExpert system mounts a volume file to create a "virtual drive" that appears to applications and...
 
wipeprotectcontainerblowfishshredvolumediskflyvirtualdrivepasswordcastencryption
ThunderSite Free Web Editor

Freeware by Generalia Software
352 x 12164Kb downloads

...belongs to a new generation of high quality website editors that allow you to create professional-looking websites...in record time and with maximum ease. To create a website with ThunderSite, you do not need...any prior knowledge of programming (HTML, JavaScript) or web design. Since most of the complex programming steps...have to bother with the technical part of website creation; instead, you can focus all your efforts...
 
htmleditoreasilycreationinternettemplatebeginnerdesigncreateeasywebsitepagescreatorbuild
PassportODBC

Freeware by Embassy Software Inc
74 x 21066Kb downloads

...to correlate an ODBC structure with an Alias. Create a new alias, select the Database Drive Name,...
 
odbc dumpodbc reloadodbc editorodbc toolodbc viewerodbc copy
dhtmlxToolbar

Freeware by Scand
78 x 49Kb downloads

...to build a user friendly interface for a web application. dhtmlxToolbar is an advanced JavaScript navigation component...that enables to create an attractive vertical or horizontal DHTML toolbar within...powerful JavaScript API allows this Javascript component to create superior DHTML toolbar....
 
toolbar builderdhtml toolbarweb toolbarjavascript toolbartoolbar creatorcustomizable toolbarjavascript componentweb developmentfree toolbartoolbar makejavascript navigationscandcreate toolbar
Assorted

Shareware by All-Sweets
158 x 512Kb downloads

...and colors. Using Assorted screensaver you can to create set various abstract wallpaper for your desktop....
 
abstractscreensaverwallpaperimagespictures